Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YWS9

Protein Details
Accession A0A4Z0YWS9    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
363-389VSGTSGGRRRGRRRVIRKKQVMDEKGYBasic
NLS Segment(s)
PositionSequence
172-238ARKRERRGRPIPATNAPQPKIESKPPVKQEAKPSATVAIKEEPKPASKSAAPSAPAKKPTPAASLKR
251-257AAAKPKK
369-381GRRRGRRRVIRKK
Subcellular Location(s) nucl 18.5, mito_nucl 10, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MDDYKQYLAQKILTEDQVVTYRFLSRALKVHVNTAKEMLYSFHKWQNDKRPGTLHATYIIYGSKSRPVKQDEDVEMTDSQASEAMDAPFSDLVSTYTLSLVSQEQLQGELEPEPEPEPESLSQYSEVVSIHVYSLAPHPLKDLQILTDTARQVLELSTTDSKVCGTIANPNARKRERRGRPIPATNAPQPKIESKPPVKQEAKPSATVAIKEEPKPASKSAAPSAPAKKPTPAASLKRQGSSGISQMFAKAAAKPKKPVAKSIDSPTTPAAASGAEDNRTSGAMSDDGEDDAEPMAEVKHEDGSARQARKDRQADLRRMMEESDEEEEPEKTADSPEDDPMDEESPPPEPEPEPKVEEPAEVVSGTSGGRRRGRRRVIRKKQVMDEKGYLVTMQEPGWESFSEDEAPLLPPKAKQQQQTVKSEPAGKPKKGTAKAAGQGAGQGNIMSFFSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.28
4 0.3
5 0.28
6 0.25
7 0.21
8 0.23
9 0.21
10 0.25
11 0.25
12 0.24
13 0.3
14 0.35
15 0.41
16 0.39
17 0.48
18 0.49
19 0.49
20 0.46
21 0.42
22 0.36
23 0.29
24 0.29
25 0.22
26 0.23
27 0.25
28 0.29
29 0.32
30 0.37
31 0.41
32 0.5
33 0.59
34 0.63
35 0.62
36 0.62
37 0.6
38 0.59
39 0.62
40 0.56
41 0.46
42 0.4
43 0.37
44 0.33
45 0.29
46 0.26
47 0.19
48 0.18
49 0.18
50 0.22
51 0.26
52 0.3
53 0.36
54 0.4
55 0.44
56 0.48
57 0.55
58 0.52
59 0.53
60 0.49
61 0.45
62 0.39
63 0.34
64 0.29
65 0.21
66 0.16
67 0.11
68 0.1
69 0.08
70 0.1
71 0.1
72 0.1
73 0.1
74 0.11
75 0.1
76 0.1
77 0.09
78 0.07
79 0.08
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.08
89 0.09
90 0.1
91 0.1
92 0.1
93 0.11
94 0.1
95 0.1
96 0.1
97 0.1
98 0.09
99 0.1
100 0.1
101 0.1
102 0.12
103 0.11
104 0.13
105 0.13
106 0.16
107 0.16
108 0.16
109 0.17
110 0.15
111 0.15
112 0.13
113 0.12
114 0.09
115 0.09
116 0.08
117 0.07
118 0.08
119 0.07
120 0.07
121 0.1
122 0.15
123 0.15
124 0.15
125 0.17
126 0.18
127 0.19
128 0.2
129 0.19
130 0.14
131 0.15
132 0.17
133 0.16
134 0.18
135 0.18
136 0.17
137 0.16
138 0.14
139 0.13
140 0.12
141 0.11
142 0.07
143 0.11
144 0.12
145 0.13
146 0.13
147 0.12
148 0.12
149 0.11
150 0.11
151 0.08
152 0.07
153 0.14
154 0.19
155 0.28
156 0.33
157 0.37
158 0.45
159 0.49
160 0.54
161 0.54
162 0.59
163 0.6
164 0.66
165 0.7
166 0.73
167 0.76
168 0.79
169 0.77
170 0.72
171 0.67
172 0.64
173 0.62
174 0.53
175 0.46
176 0.41
177 0.38
178 0.36
179 0.36
180 0.38
181 0.36
182 0.42
183 0.44
184 0.51
185 0.51
186 0.51
187 0.56
188 0.57
189 0.54
190 0.48
191 0.45
192 0.4
193 0.37
194 0.33
195 0.27
196 0.22
197 0.22
198 0.22
199 0.25
200 0.22
201 0.24
202 0.26
203 0.24
204 0.22
205 0.21
206 0.23
207 0.22
208 0.24
209 0.22
210 0.25
211 0.29
212 0.3
213 0.32
214 0.3
215 0.29
216 0.29
217 0.3
218 0.31
219 0.33
220 0.34
221 0.38
222 0.45
223 0.46
224 0.44
225 0.42
226 0.36
227 0.32
228 0.28
229 0.24
230 0.17
231 0.15
232 0.14
233 0.14
234 0.13
235 0.11
236 0.1
237 0.1
238 0.18
239 0.24
240 0.26
241 0.29
242 0.35
243 0.43
244 0.43
245 0.48
246 0.46
247 0.46
248 0.48
249 0.51
250 0.51
251 0.44
252 0.44
253 0.37
254 0.32
255 0.25
256 0.21
257 0.15
258 0.08
259 0.08
260 0.09
261 0.1
262 0.1
263 0.1
264 0.1
265 0.1
266 0.1
267 0.1
268 0.07
269 0.07
270 0.06
271 0.07
272 0.08
273 0.08
274 0.08
275 0.08
276 0.08
277 0.07
278 0.06
279 0.06
280 0.04
281 0.04
282 0.04
283 0.04
284 0.05
285 0.05
286 0.06
287 0.07
288 0.07
289 0.08
290 0.16
291 0.23
292 0.24
293 0.27
294 0.32
295 0.36
296 0.46
297 0.5
298 0.47
299 0.51
300 0.58
301 0.61
302 0.62
303 0.62
304 0.54
305 0.5
306 0.45
307 0.35
308 0.28
309 0.23
310 0.19
311 0.15
312 0.14
313 0.15
314 0.15
315 0.14
316 0.13
317 0.11
318 0.08
319 0.09
320 0.09
321 0.12
322 0.14
323 0.16
324 0.17
325 0.17
326 0.17
327 0.19
328 0.19
329 0.16
330 0.14
331 0.13
332 0.14
333 0.15
334 0.14
335 0.14
336 0.14
337 0.2
338 0.24
339 0.27
340 0.31
341 0.3
342 0.34
343 0.32
344 0.31
345 0.28
346 0.24
347 0.21
348 0.15
349 0.14
350 0.09
351 0.1
352 0.09
353 0.11
354 0.13
355 0.19
356 0.26
357 0.36
358 0.44
359 0.54
360 0.65
361 0.72
362 0.8
363 0.85
364 0.89
365 0.91
366 0.93
367 0.91
368 0.9
369 0.89
370 0.84
371 0.79
372 0.72
373 0.63
374 0.54
375 0.46
376 0.36
377 0.26
378 0.22
379 0.17
380 0.13
381 0.13
382 0.14
383 0.15
384 0.17
385 0.17
386 0.16
387 0.16
388 0.18
389 0.17
390 0.15
391 0.14
392 0.13
393 0.15
394 0.16
395 0.16
396 0.16
397 0.16
398 0.25
399 0.35
400 0.4
401 0.44
402 0.53
403 0.61
404 0.68
405 0.75
406 0.72
407 0.68
408 0.66
409 0.68
410 0.62
411 0.63
412 0.64
413 0.58
414 0.58
415 0.6
416 0.66
417 0.64
418 0.66
419 0.63
420 0.64
421 0.66
422 0.65
423 0.58
424 0.48
425 0.47
426 0.41
427 0.34
428 0.25
429 0.19
430 0.15
431 0.14
432 0.14