Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9ME90

Protein Details
Accession G9ME90    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MQKEKRKTRKIGKKRKENKNGMKKKKIEKHWTRFPSLBasic
NLS Segment(s)
PositionSequence
3-29KEKRKTRKIGKKRKENKNGMKKKKIEK
Subcellular Location(s) nucl 16.5, mito_nucl 13.833, cyto_nucl 9.666, mito 9
Family & Domain DBs
Amino Acid Sequences MQKEKRKTRKIGKKRKENKNGMKKKKIEKHWTRFPSLVPTFVGETFFQSSPRPPFLCNTSSFLINESPLVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.95
3 0.94
4 0.94
5 0.94
6 0.94
7 0.94
8 0.93
9 0.92
10 0.88
11 0.88
12 0.86
13 0.85
14 0.84
15 0.84
16 0.83
17 0.84
18 0.8
19 0.74
20 0.66
21 0.57
22 0.54
23 0.44
24 0.36
25 0.26
26 0.23
27 0.2
28 0.19
29 0.2
30 0.11
31 0.13
32 0.15
33 0.14
34 0.14
35 0.14
36 0.19
37 0.22
38 0.27
39 0.26
40 0.24
41 0.28
42 0.32
43 0.35
44 0.33
45 0.33
46 0.3
47 0.31
48 0.3
49 0.28
50 0.25
51 0.22