Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YNU0

Protein Details
Accession A0A4Z0YNU0    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
217-236TQLSGKRKKKSKDDDDPWASHydrophilic
NLS Segment(s)
PositionSequence
37-107GQRGAKTKGAPVQPADNLKRKRTTTPKDDAPRAFKRIMAYASGKKPRSGLDNGDEPRGAKAKKRSAAQKAK
222-228KRKKKSK
237-242LRKKRG
Subcellular Location(s) nucl 14.5, cyto_nucl 11.333, cyto 7, cyto_mito 5.833, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038871  C607.02c-like  
Amino Acid Sequences MPHKHTRRQRDESTFDLPPTQIAKSLPVNQPKPKENGQRGAKTKGAPVQPADNLKRKRTTTPKDDAPRAFKRIMAYASGKKPRSGLDNGDEPRGAKAKKRSAAQKAKSAETQVEVKPAAAAVPTIRPGERMSEFSARVDAALPLAGLVNKSMKGNKDPLGLKVWRTNKERKMHKMYDEWREQELKAKDKREEELELEAERELEEEETGVSWKLNIGTQLSGKRKKKSKDDDDPWASLRKKRGETRPGLRDVAVAPPELTVKPLKQLLVRGAAVEVNDIPKSAGSLKQREDLQVARNDILAAYRKKMGEKRPSLHTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.56
3 0.5
4 0.4
5 0.34
6 0.31
7 0.25
8 0.22
9 0.2
10 0.24
11 0.27
12 0.35
13 0.39
14 0.46
15 0.53
16 0.58
17 0.65
18 0.65
19 0.66
20 0.67
21 0.7
22 0.69
23 0.72
24 0.73
25 0.75
26 0.74
27 0.74
28 0.69
29 0.6
30 0.57
31 0.54
32 0.49
33 0.43
34 0.41
35 0.41
36 0.41
37 0.48
38 0.49
39 0.51
40 0.53
41 0.55
42 0.6
43 0.57
44 0.62
45 0.64
46 0.67
47 0.67
48 0.7
49 0.74
50 0.75
51 0.79
52 0.76
53 0.74
54 0.71
55 0.67
56 0.59
57 0.51
58 0.45
59 0.42
60 0.37
61 0.33
62 0.32
63 0.34
64 0.42
65 0.48
66 0.47
67 0.43
68 0.44
69 0.41
70 0.41
71 0.38
72 0.35
73 0.31
74 0.39
75 0.39
76 0.4
77 0.37
78 0.32
79 0.3
80 0.3
81 0.26
82 0.24
83 0.31
84 0.38
85 0.43
86 0.49
87 0.55
88 0.61
89 0.71
90 0.7
91 0.69
92 0.64
93 0.61
94 0.57
95 0.49
96 0.4
97 0.31
98 0.31
99 0.23
100 0.23
101 0.2
102 0.18
103 0.16
104 0.15
105 0.12
106 0.08
107 0.07
108 0.05
109 0.07
110 0.09
111 0.1
112 0.1
113 0.11
114 0.11
115 0.15
116 0.16
117 0.17
118 0.19
119 0.22
120 0.22
121 0.21
122 0.22
123 0.17
124 0.16
125 0.14
126 0.1
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.06
137 0.07
138 0.09
139 0.11
140 0.13
141 0.17
142 0.19
143 0.23
144 0.24
145 0.25
146 0.28
147 0.27
148 0.27
149 0.3
150 0.34
151 0.35
152 0.39
153 0.46
154 0.48
155 0.56
156 0.62
157 0.64
158 0.67
159 0.64
160 0.64
161 0.64
162 0.62
163 0.62
164 0.59
165 0.53
166 0.46
167 0.43
168 0.39
169 0.39
170 0.37
171 0.36
172 0.36
173 0.38
174 0.4
175 0.4
176 0.43
177 0.38
178 0.37
179 0.31
180 0.29
181 0.26
182 0.22
183 0.2
184 0.18
185 0.14
186 0.11
187 0.1
188 0.07
189 0.05
190 0.05
191 0.04
192 0.05
193 0.05
194 0.06
195 0.06
196 0.05
197 0.05
198 0.06
199 0.06
200 0.07
201 0.08
202 0.09
203 0.11
204 0.15
205 0.22
206 0.3
207 0.39
208 0.44
209 0.51
210 0.57
211 0.64
212 0.71
213 0.74
214 0.77
215 0.78
216 0.8
217 0.82
218 0.79
219 0.74
220 0.65
221 0.62
222 0.54
223 0.47
224 0.48
225 0.45
226 0.48
227 0.54
228 0.62
229 0.63
230 0.7
231 0.75
232 0.76
233 0.73
234 0.67
235 0.59
236 0.5
237 0.42
238 0.39
239 0.3
240 0.22
241 0.17
242 0.16
243 0.18
244 0.16
245 0.18
246 0.15
247 0.14
248 0.19
249 0.21
250 0.23
251 0.24
252 0.28
253 0.3
254 0.33
255 0.32
256 0.28
257 0.26
258 0.25
259 0.22
260 0.2
261 0.16
262 0.12
263 0.12
264 0.12
265 0.11
266 0.1
267 0.12
268 0.13
269 0.18
270 0.23
271 0.31
272 0.34
273 0.39
274 0.41
275 0.42
276 0.44
277 0.42
278 0.42
279 0.42
280 0.42
281 0.36
282 0.35
283 0.32
284 0.28
285 0.28
286 0.29
287 0.25
288 0.25
289 0.3
290 0.31
291 0.38
292 0.46
293 0.52
294 0.55
295 0.62
296 0.63