Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YRB1

Protein Details
Accession A0A4Z0YRB1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-82PPGLQIKEVPKKNKKGKHTABasic
NLS Segment(s)
PositionSequence
71-80VPKKNKKGKH
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEIADIKRFIEICRRDDAKSARVKKSSRSSQTKFKVRCSKQLYTLVLKDNDKAEKLKQSLPPGLQIKEVPKKNKKGKHTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.37
3 0.4
4 0.36
5 0.43
6 0.47
7 0.45
8 0.5
9 0.54
10 0.53
11 0.57
12 0.57
13 0.58
14 0.63
15 0.66
16 0.65
17 0.67
18 0.65
19 0.69
20 0.76
21 0.77
22 0.7
23 0.69
24 0.7
25 0.63
26 0.68
27 0.66
28 0.59
29 0.57
30 0.6
31 0.54
32 0.48
33 0.48
34 0.42
35 0.39
36 0.36
37 0.31
38 0.27
39 0.26
40 0.24
41 0.23
42 0.22
43 0.26
44 0.29
45 0.33
46 0.35
47 0.39
48 0.43
49 0.42
50 0.48
51 0.45
52 0.43
53 0.39
54 0.37
55 0.4
56 0.43
57 0.5
58 0.52
59 0.57
60 0.66
61 0.74
62 0.8