Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YF59

Protein Details
Accession A0A4Z0YF59    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-93LSEKRTTRDGNPPKRRGPKPDSKPALTHydrophilic
NLS Segment(s)
PositionSequence
76-95GNPPKRRGPKPDSKPALTRR
Subcellular Location(s) nucl 13.5, mito_nucl 10.833, mito 7, cyto_mito 6.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MATMTANVGAASYPSPPQYSPPSDKPMIDAGYEPNSMSSSSSPHAAHGGPGDKSPLSSLNLNFLKTLSEKRTTRDGNPPKRRGPKPDSKPALTRRQELNRQAQRTHRERKELYIKALEDEVLRLKEVFSNVSQDKDKIAEENRQLRNLLHQNGIASSSVAAMDDVISNPSMGYTSSGSISGSYAPGSSSAFTPPMTSISSLPSVAGSGQMMGGHMGQHPVQSVVDYDQAGIDFVLAYELPVDPSKAYMSPPHQAVAELNGEIPFGRNHSAVVDGVESKTKRGEQQSLKTWELSKGDLTTLLDLSKRLDLDGEITPVMAWGMILGHPRLTELTRKDFEKITDDMKDKVRCYGFGAVMEEFEVRDSLNAVLSAKPEASLGAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.21
5 0.28
6 0.36
7 0.42
8 0.47
9 0.53
10 0.54
11 0.54
12 0.52
13 0.5
14 0.43
15 0.36
16 0.31
17 0.27
18 0.28
19 0.28
20 0.25
21 0.19
22 0.18
23 0.18
24 0.17
25 0.14
26 0.14
27 0.15
28 0.2
29 0.19
30 0.19
31 0.22
32 0.2
33 0.21
34 0.22
35 0.25
36 0.21
37 0.21
38 0.24
39 0.21
40 0.21
41 0.21
42 0.19
43 0.18
44 0.22
45 0.22
46 0.28
47 0.3
48 0.3
49 0.29
50 0.26
51 0.25
52 0.23
53 0.29
54 0.25
55 0.32
56 0.33
57 0.37
58 0.46
59 0.48
60 0.51
61 0.55
62 0.6
63 0.63
64 0.72
65 0.76
66 0.76
67 0.82
68 0.83
69 0.82
70 0.81
71 0.8
72 0.79
73 0.82
74 0.8
75 0.75
76 0.77
77 0.76
78 0.77
79 0.7
80 0.67
81 0.65
82 0.66
83 0.7
84 0.69
85 0.72
86 0.69
87 0.69
88 0.67
89 0.66
90 0.66
91 0.67
92 0.69
93 0.64
94 0.65
95 0.62
96 0.67
97 0.69
98 0.64
99 0.6
100 0.56
101 0.5
102 0.43
103 0.42
104 0.33
105 0.23
106 0.21
107 0.19
108 0.13
109 0.13
110 0.12
111 0.11
112 0.13
113 0.13
114 0.14
115 0.11
116 0.17
117 0.18
118 0.21
119 0.22
120 0.2
121 0.2
122 0.2
123 0.19
124 0.17
125 0.19
126 0.22
127 0.28
128 0.37
129 0.38
130 0.38
131 0.39
132 0.35
133 0.41
134 0.4
135 0.36
136 0.29
137 0.27
138 0.25
139 0.25
140 0.26
141 0.17
142 0.11
143 0.08
144 0.07
145 0.06
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.04
158 0.04
159 0.05
160 0.06
161 0.06
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.07
168 0.06
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.06
175 0.06
176 0.07
177 0.07
178 0.07
179 0.08
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.1
186 0.11
187 0.11
188 0.1
189 0.09
190 0.08
191 0.07
192 0.07
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.05
201 0.05
202 0.06
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.06
209 0.07
210 0.07
211 0.09
212 0.09
213 0.08
214 0.08
215 0.08
216 0.08
217 0.07
218 0.05
219 0.03
220 0.03
221 0.04
222 0.03
223 0.03
224 0.04
225 0.04
226 0.05
227 0.06
228 0.06
229 0.06
230 0.07
231 0.08
232 0.08
233 0.1
234 0.14
235 0.17
236 0.21
237 0.22
238 0.22
239 0.21
240 0.21
241 0.2
242 0.18
243 0.16
244 0.12
245 0.11
246 0.1
247 0.1
248 0.09
249 0.1
250 0.07
251 0.08
252 0.1
253 0.09
254 0.1
255 0.1
256 0.12
257 0.11
258 0.11
259 0.11
260 0.1
261 0.11
262 0.16
263 0.15
264 0.15
265 0.17
266 0.19
267 0.23
268 0.28
269 0.36
270 0.4
271 0.48
272 0.56
273 0.6
274 0.59
275 0.56
276 0.52
277 0.47
278 0.41
279 0.34
280 0.27
281 0.21
282 0.2
283 0.2
284 0.19
285 0.16
286 0.15
287 0.14
288 0.13
289 0.12
290 0.14
291 0.14
292 0.14
293 0.12
294 0.12
295 0.12
296 0.14
297 0.16
298 0.16
299 0.13
300 0.13
301 0.12
302 0.12
303 0.11
304 0.07
305 0.05
306 0.03
307 0.04
308 0.06
309 0.08
310 0.09
311 0.1
312 0.1
313 0.11
314 0.13
315 0.15
316 0.21
317 0.24
318 0.32
319 0.35
320 0.37
321 0.39
322 0.41
323 0.41
324 0.39
325 0.36
326 0.33
327 0.36
328 0.37
329 0.38
330 0.43
331 0.46
332 0.42
333 0.47
334 0.44
335 0.38
336 0.4
337 0.43
338 0.37
339 0.34
340 0.37
341 0.29
342 0.27
343 0.27
344 0.22
345 0.15
346 0.14
347 0.11
348 0.08
349 0.08
350 0.09
351 0.08
352 0.1
353 0.11
354 0.11
355 0.13
356 0.14
357 0.16
358 0.14
359 0.14
360 0.12