Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YLP0

Protein Details
Accession A0A4Z0YLP0    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
159-179SSVPSKTKRGRATVPRSRRLWHydrophilic
NLS Segment(s)
PositionSequence
164-171KTKRGRAT
Subcellular Location(s) nucl 13, cyto 11, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR008949  Isoprenoid_synthase_dom_sf  
IPR002060  Squ/phyt_synthse  
IPR019845  Squalene/phytoene_synthase_CS  
Gene Ontology GO:0016765  F:transferase activity, transferring alkyl or aryl (other than methyl) groups  
GO:0009058  P:biosynthetic process  
Pfam View protein in Pfam  
PF00494  SQS_PSY  
PROSITE View protein in PROSITE  
PS01045  SQUALEN_PHYTOEN_SYN_2  
Amino Acid Sequences MDLAFTDADFPIKNEADIQTYASRVASTVGELCIWLVFHHGSVKLPEDKKSRLVQAAITMGYALQYVNIARDIQVDAEMGRVYLPTNWLGEEGLVPQDIINNPRQPKAEILRQKLLDLAFKEYQESRSTMNLLPNDIRGPLIVAVESYMEIGRVLREKSSVPSKTKRGRATVPRSRRLWVAWKNLSRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.2
4 0.21
5 0.23
6 0.19
7 0.19
8 0.2
9 0.17
10 0.16
11 0.12
12 0.13
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.1
19 0.1
20 0.09
21 0.09
22 0.07
23 0.08
24 0.08
25 0.08
26 0.11
27 0.12
28 0.13
29 0.14
30 0.19
31 0.24
32 0.25
33 0.31
34 0.34
35 0.36
36 0.41
37 0.43
38 0.43
39 0.39
40 0.38
41 0.33
42 0.3
43 0.3
44 0.24
45 0.2
46 0.15
47 0.12
48 0.11
49 0.09
50 0.06
51 0.03
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.08
60 0.07
61 0.08
62 0.07
63 0.06
64 0.07
65 0.07
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.05
81 0.05
82 0.05
83 0.04
84 0.06
85 0.07
86 0.09
87 0.12
88 0.16
89 0.18
90 0.21
91 0.22
92 0.21
93 0.26
94 0.28
95 0.34
96 0.37
97 0.41
98 0.44
99 0.44
100 0.43
101 0.4
102 0.36
103 0.31
104 0.24
105 0.25
106 0.2
107 0.2
108 0.22
109 0.21
110 0.22
111 0.2
112 0.2
113 0.16
114 0.16
115 0.19
116 0.19
117 0.23
118 0.22
119 0.23
120 0.22
121 0.22
122 0.21
123 0.18
124 0.16
125 0.11
126 0.12
127 0.1
128 0.09
129 0.07
130 0.07
131 0.07
132 0.07
133 0.07
134 0.06
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.11
141 0.11
142 0.12
143 0.13
144 0.15
145 0.21
146 0.3
147 0.35
148 0.39
149 0.46
150 0.55
151 0.63
152 0.7
153 0.71
154 0.69
155 0.72
156 0.76
157 0.78
158 0.79
159 0.8
160 0.8
161 0.76
162 0.72
163 0.66
164 0.61
165 0.6
166 0.59
167 0.59
168 0.6