Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YFT3

Protein Details
Accession A0A4Z0YFT3    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
57-78LTKKTKASSSGKKKGYKHRSEYHydrophilic
NLS Segment(s)
PositionSequence
65-73SSGKKKGYK
Subcellular Location(s) mito 11, cyto 8.5, cyto_nucl 8.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MSFAEARKGRTGPYDFVGSVSAVVEKDESAAATTSSSVAHGPRGSRKSTYDASVDYLTKKTKASSSGKKKGYKHRSEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.29
4 0.29
5 0.21
6 0.17
7 0.14
8 0.11
9 0.07
10 0.08
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.06
24 0.06
25 0.06
26 0.07
27 0.08
28 0.1
29 0.16
30 0.19
31 0.21
32 0.23
33 0.25
34 0.28
35 0.29
36 0.3
37 0.26
38 0.24
39 0.25
40 0.25
41 0.24
42 0.2
43 0.21
44 0.21
45 0.21
46 0.21
47 0.19
48 0.21
49 0.28
50 0.36
51 0.43
52 0.52
53 0.61
54 0.68
55 0.74
56 0.79
57 0.82
58 0.84