Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YBJ3

Protein Details
Accession A0A4Z0YBJ3    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
99-125YRTVRHGRLVRKSRRARRAKNGSRSEVBasic
NLS Segment(s)
PositionSequence
105-120GRLVRKSRRARRAKNG
Subcellular Location(s) nucl 16.5, cyto_nucl 12.333, cyto 7, cyto_pero 4.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013952  DUF1776_fun  
Pfam View protein in Pfam  
PF08643  DUF1776  
Amino Acid Sequences MSADDQQFWDLLSSVPNHVRQYSGDVAEFLDRTVDKAAENVRDTLASTSWIPDYARPKAPSPPPVRMVPVSTWESMQNWVVRHKFVSGVFVCAVGYVTYRTVRHGRLVRKSRRARRAKNGSRSEVVVIAGSPSLPLTKSLSLDLERRGFIVYIVCNTIEDEMMVQHASRPDIRGLSIDITD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.21
3 0.24
4 0.26
5 0.26
6 0.27
7 0.25
8 0.3
9 0.3
10 0.28
11 0.24
12 0.22
13 0.22
14 0.23
15 0.22
16 0.15
17 0.13
18 0.11
19 0.12
20 0.14
21 0.13
22 0.11
23 0.14
24 0.18
25 0.2
26 0.22
27 0.21
28 0.2
29 0.2
30 0.21
31 0.19
32 0.16
33 0.12
34 0.11
35 0.11
36 0.11
37 0.12
38 0.12
39 0.15
40 0.2
41 0.23
42 0.3
43 0.31
44 0.32
45 0.39
46 0.44
47 0.49
48 0.49
49 0.5
50 0.47
51 0.46
52 0.47
53 0.41
54 0.38
55 0.3
56 0.29
57 0.25
58 0.22
59 0.21
60 0.18
61 0.18
62 0.17
63 0.18
64 0.16
65 0.14
66 0.18
67 0.19
68 0.18
69 0.18
70 0.17
71 0.18
72 0.15
73 0.2
74 0.15
75 0.16
76 0.16
77 0.15
78 0.14
79 0.12
80 0.12
81 0.06
82 0.06
83 0.05
84 0.06
85 0.08
86 0.08
87 0.12
88 0.15
89 0.16
90 0.22
91 0.28
92 0.33
93 0.41
94 0.51
95 0.57
96 0.64
97 0.73
98 0.76
99 0.81
100 0.84
101 0.83
102 0.84
103 0.87
104 0.86
105 0.87
106 0.85
107 0.79
108 0.71
109 0.63
110 0.53
111 0.43
112 0.33
113 0.23
114 0.15
115 0.11
116 0.09
117 0.07
118 0.06
119 0.05
120 0.05
121 0.05
122 0.07
123 0.1
124 0.12
125 0.13
126 0.15
127 0.17
128 0.19
129 0.22
130 0.26
131 0.25
132 0.23
133 0.23
134 0.22
135 0.19
136 0.17
137 0.18
138 0.15
139 0.14
140 0.15
141 0.15
142 0.14
143 0.15
144 0.15
145 0.11
146 0.1
147 0.08
148 0.07
149 0.08
150 0.08
151 0.08
152 0.1
153 0.12
154 0.15
155 0.16
156 0.18
157 0.21
158 0.22
159 0.23
160 0.22
161 0.22