Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z726

Protein Details
Accession A0A4Z0Z726    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
22-43HVYTSQKSTKKPREPYPPLFTPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045038  AIG2-like  
IPR036568  GGCT-like_sf  
Amino Acid Sequences MASTKFPLKTTHFHRASYVVGHVYTSQKSTKKPREPYPPLFTPPTFKPCYMFIYGTLMDPDVLQYITREVSGEGDAQTGESESTIKIHGMFWQVEDYQHFWVLQQYETSAYRERWCQIHVEDNSEVLEGSVVFVWAKKPQNPDLMDGVFDLTKWQKTDKPSLFTTNKEHGPGRELDYLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.45
4 0.39
5 0.34
6 0.25
7 0.22
8 0.21
9 0.21
10 0.21
11 0.21
12 0.21
13 0.24
14 0.26
15 0.33
16 0.44
17 0.52
18 0.58
19 0.66
20 0.72
21 0.78
22 0.83
23 0.84
24 0.82
25 0.76
26 0.71
27 0.67
28 0.58
29 0.53
30 0.49
31 0.47
32 0.42
33 0.37
34 0.34
35 0.32
36 0.35
37 0.34
38 0.29
39 0.23
40 0.25
41 0.25
42 0.23
43 0.2
44 0.16
45 0.12
46 0.11
47 0.11
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.06
57 0.07
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.05
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.08
76 0.1
77 0.1
78 0.1
79 0.11
80 0.12
81 0.12
82 0.13
83 0.12
84 0.1
85 0.11
86 0.1
87 0.09
88 0.11
89 0.12
90 0.11
91 0.1
92 0.09
93 0.11
94 0.12
95 0.14
96 0.14
97 0.15
98 0.17
99 0.19
100 0.21
101 0.2
102 0.2
103 0.21
104 0.2
105 0.27
106 0.26
107 0.29
108 0.27
109 0.25
110 0.25
111 0.22
112 0.2
113 0.11
114 0.1
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.05
121 0.07
122 0.13
123 0.18
124 0.21
125 0.27
126 0.31
127 0.4
128 0.41
129 0.43
130 0.42
131 0.38
132 0.35
133 0.29
134 0.26
135 0.18
136 0.16
137 0.15
138 0.13
139 0.16
140 0.17
141 0.2
142 0.23
143 0.3
144 0.41
145 0.44
146 0.46
147 0.48
148 0.56
149 0.56
150 0.56
151 0.58
152 0.55
153 0.52
154 0.51
155 0.49
156 0.42
157 0.43
158 0.41
159 0.4