Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z0P1

Protein Details
Accession A0A4Z0Z0P1    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-32AAIASREKRRQNKAEKEYQEHydrophilic
NLS Segment(s)
PositionSequence
20-28KRRQNKAEK
44-53GRVSKERRKK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MPSQEELIRMREAAIASREKRRQNKAEKEYQERKEAENRVDSAGRVSKERRKKWGGVDYRVEDADYLLNMFLPLGSFRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.27
4 0.36
5 0.42
6 0.48
7 0.56
8 0.62
9 0.67
10 0.7
11 0.78
12 0.77
13 0.8
14 0.78
15 0.8
16 0.8
17 0.74
18 0.7
19 0.61
20 0.55
21 0.53
22 0.5
23 0.43
24 0.37
25 0.34
26 0.29
27 0.28
28 0.25
29 0.21
30 0.21
31 0.19
32 0.18
33 0.22
34 0.28
35 0.37
36 0.43
37 0.49
38 0.51
39 0.55
40 0.61
41 0.67
42 0.67
43 0.64
44 0.66
45 0.61
46 0.57
47 0.52
48 0.43
49 0.33
50 0.26
51 0.2
52 0.12
53 0.1
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06