Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YW48

Protein Details
Accession A0A4Z0YW48    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
321-347LPDIYSKIRKYGKKNGHPSNYRRKDIHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045022  KDSR-like  
IPR036291  NAD(P)-bd_dom_sf  
IPR002347  SDR_fam  
Gene Ontology GO:0016020  C:membrane  
GO:0047560  F:3-dehydrosphinganine reductase activity  
GO:0006666  P:3-keto-sphinganine metabolic process  
GO:0030148  P:sphingolipid biosynthetic process  
Pfam View protein in Pfam  
PF00106  adh_short  
CDD cd08939  KDSR-like_SDR_c  
Amino Acid Sequences MDVFSQPTWIAISAGLIVLLFAVTMGGAWSKNQMPVEGKTILITGASEGMGRSAARQLAEKGANVILVSRSANKLQEAMAEAKAAARNPQTQRFHYISVDVSKPDYAGPLLTEAIAWNDGKPLDVVWCVAGKSTPDFWVEAPLSVSREHMDLNFWGSAEMAHAVLRLWCAPDAPVVPEPKHLIFTSSVVAFFTIIGYGTYTPAKAALRGLADTLAQELEIYPQKVKLHIVYPGSISSPGFERENKTKPEITSILEESDPVQTPDVVAAAAIRGLEKGHYSITVAFLGSVLRWGSLGGSPRNNWVVDTFMSWIITVVWIFALPDIYSKIRKYGKKNGHPSNYRRKDIHES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.06
4 0.06
5 0.05
6 0.05
7 0.03
8 0.03
9 0.03
10 0.02
11 0.02
12 0.03
13 0.05
14 0.05
15 0.06
16 0.1
17 0.12
18 0.17
19 0.17
20 0.21
21 0.24
22 0.26
23 0.31
24 0.28
25 0.27
26 0.23
27 0.23
28 0.19
29 0.15
30 0.12
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.08
40 0.11
41 0.13
42 0.13
43 0.16
44 0.17
45 0.23
46 0.25
47 0.24
48 0.23
49 0.21
50 0.21
51 0.18
52 0.17
53 0.11
54 0.11
55 0.12
56 0.12
57 0.14
58 0.16
59 0.18
60 0.17
61 0.18
62 0.17
63 0.18
64 0.19
65 0.19
66 0.17
67 0.16
68 0.15
69 0.16
70 0.18
71 0.16
72 0.16
73 0.17
74 0.24
75 0.29
76 0.38
77 0.41
78 0.42
79 0.49
80 0.48
81 0.47
82 0.4
83 0.37
84 0.3
85 0.29
86 0.28
87 0.22
88 0.2
89 0.18
90 0.17
91 0.15
92 0.14
93 0.1
94 0.08
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.07
101 0.07
102 0.08
103 0.08
104 0.07
105 0.08
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.08
112 0.08
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.1
120 0.11
121 0.11
122 0.11
123 0.12
124 0.12
125 0.17
126 0.16
127 0.15
128 0.14
129 0.14
130 0.14
131 0.13
132 0.14
133 0.09
134 0.09
135 0.09
136 0.08
137 0.09
138 0.08
139 0.1
140 0.1
141 0.09
142 0.09
143 0.08
144 0.08
145 0.07
146 0.07
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.07
159 0.07
160 0.09
161 0.12
162 0.13
163 0.14
164 0.15
165 0.17
166 0.16
167 0.18
168 0.15
169 0.14
170 0.13
171 0.13
172 0.13
173 0.12
174 0.11
175 0.09
176 0.09
177 0.07
178 0.06
179 0.05
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.06
186 0.06
187 0.06
188 0.06
189 0.08
190 0.08
191 0.08
192 0.09
193 0.1
194 0.1
195 0.11
196 0.11
197 0.09
198 0.09
199 0.08
200 0.08
201 0.06
202 0.05
203 0.05
204 0.04
205 0.07
206 0.1
207 0.11
208 0.11
209 0.14
210 0.15
211 0.16
212 0.17
213 0.17
214 0.16
215 0.2
216 0.21
217 0.19
218 0.2
219 0.19
220 0.19
221 0.17
222 0.15
223 0.11
224 0.11
225 0.12
226 0.13
227 0.15
228 0.19
229 0.25
230 0.32
231 0.35
232 0.37
233 0.39
234 0.38
235 0.43
236 0.4
237 0.35
238 0.33
239 0.31
240 0.28
241 0.24
242 0.23
243 0.18
244 0.19
245 0.17
246 0.13
247 0.12
248 0.1
249 0.1
250 0.11
251 0.1
252 0.06
253 0.05
254 0.05
255 0.04
256 0.05
257 0.05
258 0.04
259 0.04
260 0.05
261 0.06
262 0.07
263 0.08
264 0.09
265 0.09
266 0.1
267 0.11
268 0.13
269 0.13
270 0.11
271 0.1
272 0.1
273 0.1
274 0.08
275 0.09
276 0.08
277 0.07
278 0.07
279 0.07
280 0.08
281 0.11
282 0.16
283 0.19
284 0.24
285 0.25
286 0.3
287 0.33
288 0.32
289 0.3
290 0.25
291 0.24
292 0.2
293 0.21
294 0.18
295 0.16
296 0.16
297 0.16
298 0.15
299 0.12
300 0.12
301 0.1
302 0.08
303 0.07
304 0.06
305 0.07
306 0.07
307 0.08
308 0.07
309 0.09
310 0.12
311 0.16
312 0.2
313 0.21
314 0.29
315 0.36
316 0.44
317 0.51
318 0.58
319 0.66
320 0.72
321 0.82
322 0.84
323 0.86
324 0.88
325 0.89
326 0.9
327 0.89
328 0.85
329 0.77