FuNGI

C4R1K8

Protein Details

Accession

C4R1K8

Localization Confidence

High

Confidence Score

23.5

NoLS Segment(s)

Position	Sequence	Protein Nature
6-33	TTERKLKAPLSGRKRVPKKTAHACNYCH	Hydrophilic
39-74	CDDSRPCKRCIQRNLADSCRDAPRKKKKYLMDIPDE	Hydrophilic
244-268	SQIERTKRYNPKEFRRRNKKSAISF	Hydrophilic

NLS Segment(s)

Position	Sequence
10-24	KLKAPLSGRKRVPKK
258-262	RRRNK

Subcellular Location(s)

nucl 22, plas 4

Family & Domain DBs

InterPro	View protein in InterPro IPR000014 PAS IPR035965 PAS-like_dom_sf IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0001227 F:DNA-binding transcription repressor activity, RNA polymerase II-specific GO:0043565 F:sequence-specific DNA binding GO:0008270 F:zinc ion binding GO:0006094 P:gluconeogenesis GO:0061415 P:negative regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source GO:0061414 P:positive regulation of transcription from RNA polymerase II promoter by a nonfermentable carbon source
KEGG	ppa:PAS_chr2-1_0732 -
Pfam	View protein in Pfam PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4 cd00130 PAS

Amino Acid Sequences

MVDKATTERKLKAPLSGRKRVPKKTAHACNYCHQAHMTCDDSRPCKRCIQRNLADSCRDAPRKKKKYLMDIPDEVADPSAQQLTPDAVMGPSPSTMTLSQSNAFMSSAADLEYSILGNIIHQDSGQFVGTDGTVISPSISTSDDNSHITPLAHYNGAIQGPAVYTKSPLNFEGSYAMTPIQRRTDINEIQPDLLRSEPSSNDTFGPTLHGEEPSCDSSTNQYFIGPSFSSDGRAQTLTFPYVVSQIERTKRYNPKEFRRRNKKSAISFSVGLMTDESSDKRDESITGLVYHEPSEIYSKIKRPYSYPQYYHSLILYLRKRFDKESLVAMSKAMAEYRPSFIAGTMNLKEDDLIFTEQCFQRTLLEYDNYISISGTPTVVWRRTSQLAYVGSEFCVLTGWSKEQLLGRSTFIVEILDDKSVLDYFELFSKIAFGDFRGATMTECTLLTPDGKKIRTSSIWTLKRDVFGIPMMVIANFLPILT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.6
2	0.65
3	0.7
4	0.73
5	0.75
6	0.83
7	0.84
8	0.83
9	0.82
10	0.83
11	0.84
12	0.86
13	0.86
14	0.84
15	0.79
16	0.78
17	0.76
18	0.67
19	0.58
20	0.5
21	0.43
22	0.38
23	0.39
24	0.35
25	0.29
26	0.33
27	0.37
28	0.42
29	0.48
30	0.49
31	0.47
32	0.53
33	0.59
34	0.64
35	0.68
36	0.71
37	0.71
38	0.76
39	0.8
40	0.77
41	0.72
42	0.64
43	0.58
44	0.57
45	0.56
46	0.54
47	0.56
48	0.61
49	0.67
50	0.73
51	0.77
52	0.76
53	0.79
54	0.83
55	0.82
56	0.79
57	0.73
58	0.67
59	0.6
60	0.52
61	0.41
62	0.32
63	0.22
64	0.13
65	0.11
66	0.11
67	0.09
68	0.09
69	0.1
70	0.11
71	0.11
72	0.11
73	0.1
74	0.08
75	0.08
76	0.09
77	0.09
78	0.07
79	0.08
80	0.08
81	0.1
82	0.1
83	0.13
84	0.16
85	0.18
86	0.19
87	0.19
88	0.19
89	0.17
90	0.17
91	0.14
92	0.11
93	0.09
94	0.08
95	0.07
96	0.07
97	0.06
98	0.06
99	0.07
100	0.06
101	0.05
102	0.05
103	0.05
104	0.05
105	0.07
106	0.07
107	0.07
108	0.07
109	0.07
110	0.08
111	0.09
112	0.1
113	0.07
114	0.07
115	0.07
116	0.07
117	0.08
118	0.07
119	0.06
120	0.05
121	0.05
122	0.05
123	0.05
124	0.05
125	0.06
126	0.07
127	0.07
128	0.09
129	0.12
130	0.14
131	0.16
132	0.17
133	0.16
134	0.16
135	0.16
136	0.15
137	0.14
138	0.14
139	0.12
140	0.12
141	0.12
142	0.13
143	0.13
144	0.12
145	0.09
146	0.08
147	0.08
148	0.09
149	0.09
150	0.06
151	0.08
152	0.1
153	0.12
154	0.14
155	0.14
156	0.18
157	0.17
158	0.17
159	0.18
160	0.17
161	0.15
162	0.14
163	0.14
164	0.12
165	0.13
166	0.15
167	0.16
168	0.17
169	0.17
170	0.21
171	0.28
172	0.29
173	0.32
174	0.35
175	0.33
176	0.32
177	0.32
178	0.28
179	0.21
180	0.19
181	0.15
182	0.11
183	0.12
184	0.11
185	0.14
186	0.15
187	0.15
188	0.15
189	0.16
190	0.15
191	0.13
192	0.15
193	0.11
194	0.12
195	0.12
196	0.12
197	0.11
198	0.12
199	0.15
200	0.14
201	0.14
202	0.12
203	0.12
204	0.15
205	0.17
206	0.17
207	0.14
208	0.13
209	0.12
210	0.12
211	0.15
212	0.11
213	0.1
214	0.11
215	0.11
216	0.13
217	0.13
218	0.14
219	0.12
220	0.13
221	0.12
222	0.12
223	0.13
224	0.11
225	0.1
226	0.1
227	0.09
228	0.1
229	0.1
230	0.09
231	0.1
232	0.15
233	0.19
234	0.23
235	0.25
236	0.31
237	0.4
238	0.46
239	0.53
240	0.57
241	0.63
242	0.71
243	0.79
244	0.81
245	0.85
246	0.86
247	0.84
248	0.85
249	0.83
250	0.79
251	0.78
252	0.72
253	0.64
254	0.56
255	0.48
256	0.41
257	0.33
258	0.25
259	0.17
260	0.12
261	0.09
262	0.09
263	0.09
264	0.08
265	0.09
266	0.09
267	0.09
268	0.1
269	0.09
270	0.11
271	0.12
272	0.12
273	0.12
274	0.13
275	0.12
276	0.13
277	0.12
278	0.1
279	0.08
280	0.08
281	0.1
282	0.1
283	0.12
284	0.16
285	0.21
286	0.26
287	0.3
288	0.31
289	0.32
290	0.42
291	0.49
292	0.54
293	0.51
294	0.5
295	0.51
296	0.52
297	0.49
298	0.39
299	0.3
300	0.23
301	0.28
302	0.29
303	0.27
304	0.3
305	0.32
306	0.34
307	0.35
308	0.38
309	0.37
310	0.33
311	0.35
312	0.35
313	0.34
314	0.32
315	0.29
316	0.25
317	0.2
318	0.18
319	0.13
320	0.09
321	0.1
322	0.11
323	0.14
324	0.14
325	0.14
326	0.14
327	0.14
328	0.15
329	0.13
330	0.17
331	0.15
332	0.17
333	0.16
334	0.16
335	0.15
336	0.14
337	0.14
338	0.11
339	0.13
340	0.11
341	0.11
342	0.18
343	0.19
344	0.2
345	0.2
346	0.18
347	0.19
348	0.22
349	0.24
350	0.22
351	0.22
352	0.22
353	0.21
354	0.22
355	0.19
356	0.16
357	0.14
358	0.1
359	0.1
360	0.1
361	0.09
362	0.08
363	0.12
364	0.17
365	0.2
366	0.22
367	0.22
368	0.26
369	0.31
370	0.32
371	0.3
372	0.31
373	0.3
374	0.31
375	0.31
376	0.27
377	0.23
378	0.22
379	0.2
380	0.14
381	0.12
382	0.1
383	0.09
384	0.11
385	0.13
386	0.14
387	0.14
388	0.17
389	0.19
390	0.23
391	0.25
392	0.24
393	0.24
394	0.23
395	0.23
396	0.21
397	0.18
398	0.15
399	0.11
400	0.12
401	0.12
402	0.1
403	0.1
404	0.1
405	0.11
406	0.11
407	0.11
408	0.09
409	0.08
410	0.08
411	0.12
412	0.13
413	0.12
414	0.12
415	0.13
416	0.12
417	0.13
418	0.13
419	0.1
420	0.15
421	0.15
422	0.16
423	0.16
424	0.16
425	0.16
426	0.17
427	0.17
428	0.12
429	0.12
430	0.12
431	0.12
432	0.13
433	0.15
434	0.16
435	0.23
436	0.29
437	0.31
438	0.34
439	0.35
440	0.42
441	0.44
442	0.48
443	0.51
444	0.54
445	0.6
446	0.61
447	0.64
448	0.6
449	0.57
450	0.51
451	0.42
452	0.34
453	0.28
454	0.26
455	0.2
456	0.18
457	0.16
458	0.14
459	0.14
460	0.11
461	0.1

C4R1K8

3D AlphaFold-predicted Structure Viewer