Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0Z714

Protein Details
Accession A0A4Z0Z714    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-37GTTPYRPRRSVHSREKRRESREHETIBasic
NLS Segment(s)
PositionSequence
19-29RRSVHSREKRR
Subcellular Location(s) nucl 18, mito_nucl 12.833, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MVYRFSPRKGEGTTPYRPRRSVHSREKRRESREHETIADNQPKEEDEDGKNKRESEVRVTAEFFQEFNKKNHAGRVPPDPSVLPAKFLCVHCHRMVEQKDNKNPWIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.66
4 0.64
5 0.6
6 0.61
7 0.64
8 0.65
9 0.66
10 0.68
11 0.73
12 0.81
13 0.9
14 0.89
15 0.87
16 0.86
17 0.83
18 0.81
19 0.77
20 0.7
21 0.61
22 0.55
23 0.52
24 0.5
25 0.48
26 0.39
27 0.32
28 0.29
29 0.27
30 0.26
31 0.23
32 0.18
33 0.15
34 0.24
35 0.26
36 0.3
37 0.31
38 0.29
39 0.29
40 0.3
41 0.29
42 0.27
43 0.31
44 0.29
45 0.29
46 0.3
47 0.29
48 0.27
49 0.25
50 0.19
51 0.15
52 0.18
53 0.2
54 0.2
55 0.25
56 0.26
57 0.27
58 0.34
59 0.35
60 0.34
61 0.35
62 0.42
63 0.4
64 0.39
65 0.39
66 0.33
67 0.31
68 0.34
69 0.3
70 0.25
71 0.21
72 0.24
73 0.27
74 0.28
75 0.33
76 0.31
77 0.37
78 0.36
79 0.4
80 0.38
81 0.42
82 0.47
83 0.5
84 0.54
85 0.58
86 0.66
87 0.67