Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z9Z8

Protein Details
Accession A0A4Z0Z9Z8   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
102-133MGPHKNKKPYVQSKGRKFEKARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
95-133EAVKHFGMGPHKNKKPYVQSKGRKFEKARGRRRSRGFKV
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
Amino Acid Sequences MSRINRPPVSLSRVKSQITHGDQADKTVVVIGTITDDNRLLEVPKVTIAALRFTATARARITAAGGECLTLDQLALRAPTGSNTLLLRGPKNAREAVKHFGMGPHKNKKPYVQSKGRKFEKARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.47
3 0.46
4 0.48
5 0.46
6 0.48
7 0.41
8 0.42
9 0.41
10 0.41
11 0.37
12 0.27
13 0.22
14 0.18
15 0.16
16 0.09
17 0.09
18 0.07
19 0.08
20 0.09
21 0.09
22 0.08
23 0.08
24 0.08
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.09
32 0.1
33 0.09
34 0.11
35 0.1
36 0.1
37 0.1
38 0.1
39 0.1
40 0.1
41 0.16
42 0.15
43 0.18
44 0.17
45 0.17
46 0.17
47 0.16
48 0.16
49 0.12
50 0.11
51 0.09
52 0.08
53 0.07
54 0.07
55 0.07
56 0.06
57 0.04
58 0.04
59 0.03
60 0.03
61 0.04
62 0.04
63 0.04
64 0.04
65 0.05
66 0.06
67 0.08
68 0.08
69 0.09
70 0.09
71 0.11
72 0.13
73 0.15
74 0.15
75 0.18
76 0.21
77 0.22
78 0.26
79 0.29
80 0.29
81 0.33
82 0.36
83 0.35
84 0.35
85 0.32
86 0.29
87 0.29
88 0.34
89 0.36
90 0.41
91 0.46
92 0.5
93 0.55
94 0.58
95 0.61
96 0.65
97 0.68
98 0.69
99 0.7
100 0.75
101 0.8
102 0.87
103 0.86
104 0.84
105 0.78
106 0.77
107 0.77
108 0.78
109 0.78
110 0.79
111 0.82
112 0.83
113 0.89