Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0Z2H1

Protein Details
Accession A0A4Z0Z2H1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
350-376SVVIYQPWRRRIEKRRSQRIPSEVPPDHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 18, vacu 3, mito 2, extr 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004688  Ni/Co_transpt  
IPR011541  Ni/Co_transpt_high_affinity  
Gene Ontology GO:0005886  C:plasma membrane  
GO:0015099  F:nickel cation transmembrane transporter activity  
Pfam View protein in Pfam  
PF03824  NicO  
Amino Acid Sequences MPRPRSCRLPALPGRLKGLPAPVLYIILLLLGVNAVVWAATAVVLHFNPGLVGAAVLSYTLGLRHALDADHIAAIDLMTRRLVASGQRPVTVGTFFSLGHSTIVIITCIVVAATAGALRERFENFQYVGGIVGTSVSAAVLILLCVGNGWVLYRLVSKLRKVLQEPDPHSPGYGDDGVEPGSDDQAVRDLQLDGPGFLANMLRGFFRIIDRPWKMYPLGVLFGLGFDTSSEIAVLGIASVHGAQGTSLWVILIFPLLFTVDTSDGALMMTLYTSKAFARDRVAILYYSIVLTGITVVVSAFIGIIQILSLVQNVAEPQGSFWDGLTKISDHFEIVGASIVGVFVLAGVGSVVIYQPWRRRIEKRRSQRIPSEVPPDAFQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.59
3 0.55
4 0.46
5 0.44
6 0.38
7 0.3
8 0.3
9 0.25
10 0.24
11 0.22
12 0.2
13 0.14
14 0.09
15 0.09
16 0.05
17 0.05
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.02
24 0.02
25 0.02
26 0.03
27 0.03
28 0.03
29 0.04
30 0.07
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.09
38 0.06
39 0.06
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.03
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.07
52 0.08
53 0.08
54 0.09
55 0.1
56 0.11
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.11
70 0.12
71 0.18
72 0.26
73 0.27
74 0.28
75 0.29
76 0.29
77 0.29
78 0.25
79 0.19
80 0.12
81 0.11
82 0.1
83 0.12
84 0.12
85 0.11
86 0.1
87 0.1
88 0.09
89 0.09
90 0.09
91 0.08
92 0.06
93 0.06
94 0.05
95 0.05
96 0.05
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.05
105 0.05
106 0.07
107 0.09
108 0.11
109 0.12
110 0.15
111 0.15
112 0.16
113 0.16
114 0.14
115 0.13
116 0.11
117 0.09
118 0.06
119 0.05
120 0.04
121 0.03
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.05
140 0.06
141 0.08
142 0.13
143 0.16
144 0.17
145 0.21
146 0.26
147 0.29
148 0.3
149 0.36
150 0.38
151 0.44
152 0.47
153 0.47
154 0.45
155 0.41
156 0.39
157 0.32
158 0.25
159 0.2
160 0.16
161 0.11
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.05
168 0.05
169 0.05
170 0.04
171 0.04
172 0.06
173 0.06
174 0.06
175 0.07
176 0.07
177 0.07
178 0.1
179 0.1
180 0.08
181 0.09
182 0.08
183 0.07
184 0.07
185 0.07
186 0.04
187 0.05
188 0.05
189 0.04
190 0.05
191 0.06
192 0.06
193 0.08
194 0.11
195 0.12
196 0.2
197 0.22
198 0.25
199 0.25
200 0.27
201 0.26
202 0.23
203 0.24
204 0.17
205 0.16
206 0.12
207 0.12
208 0.1
209 0.09
210 0.09
211 0.07
212 0.05
213 0.03
214 0.04
215 0.04
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.03
223 0.03
224 0.02
225 0.03
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.05
240 0.04
241 0.04
242 0.04
243 0.05
244 0.05
245 0.05
246 0.07
247 0.07
248 0.07
249 0.08
250 0.07
251 0.07
252 0.07
253 0.07
254 0.04
255 0.04
256 0.03
257 0.03
258 0.04
259 0.04
260 0.05
261 0.05
262 0.1
263 0.12
264 0.14
265 0.19
266 0.22
267 0.23
268 0.24
269 0.26
270 0.21
271 0.21
272 0.19
273 0.15
274 0.11
275 0.1
276 0.07
277 0.06
278 0.05
279 0.05
280 0.04
281 0.04
282 0.03
283 0.03
284 0.04
285 0.04
286 0.04
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.04
297 0.04
298 0.04
299 0.05
300 0.05
301 0.06
302 0.07
303 0.07
304 0.07
305 0.1
306 0.11
307 0.11
308 0.11
309 0.15
310 0.15
311 0.16
312 0.17
313 0.15
314 0.16
315 0.18
316 0.18
317 0.14
318 0.14
319 0.14
320 0.12
321 0.11
322 0.11
323 0.08
324 0.08
325 0.07
326 0.06
327 0.05
328 0.04
329 0.04
330 0.02
331 0.02
332 0.02
333 0.02
334 0.02
335 0.03
336 0.03
337 0.03
338 0.03
339 0.04
340 0.07
341 0.14
342 0.21
343 0.29
344 0.36
345 0.42
346 0.53
347 0.63
348 0.71
349 0.76
350 0.81
351 0.84
352 0.87
353 0.9
354 0.89
355 0.88
356 0.85
357 0.81
358 0.79
359 0.73
360 0.65