Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0ZEC4

Protein Details
Accession A0A4Z0ZEC4   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
209-234TYTPRMSPAPKGKRRKMHANCQKLTAHydrophilic
NLS Segment(s)
PositionSequence
218-224PKGKRRK
Subcellular Location(s) mito 17, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MPTVKPKLAQLTTPVTATFPSELSALSASAKTPLSAVPTFIKEEFPGSAKTPISPPTAYMDFLKAMSVQSPVIPAKRSASGSSTPEEDSAQESVPSTASSEQTDCSCKCGGHRSPAGVPSSPYSNQPMSAPPMSVTSYPSLKVPPSPAMSTLDSPMSATIRSPFSARSARSPFDWEAALKARYSQDCRAHKATNKSVRHIREVVTRTVTYTPRMSPAPKGKRRKMHANCQKLTAAVAEVSPSSTPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.26
3 0.24
4 0.24
5 0.2
6 0.13
7 0.12
8 0.11
9 0.11
10 0.12
11 0.12
12 0.1
13 0.1
14 0.11
15 0.1
16 0.12
17 0.12
18 0.11
19 0.11
20 0.12
21 0.16
22 0.16
23 0.19
24 0.19
25 0.21
26 0.24
27 0.24
28 0.25
29 0.19
30 0.21
31 0.2
32 0.19
33 0.19
34 0.18
35 0.22
36 0.21
37 0.22
38 0.23
39 0.25
40 0.27
41 0.24
42 0.23
43 0.24
44 0.25
45 0.25
46 0.24
47 0.22
48 0.18
49 0.18
50 0.17
51 0.12
52 0.11
53 0.11
54 0.11
55 0.09
56 0.08
57 0.11
58 0.13
59 0.14
60 0.15
61 0.16
62 0.17
63 0.2
64 0.22
65 0.2
66 0.22
67 0.24
68 0.25
69 0.25
70 0.24
71 0.21
72 0.2
73 0.19
74 0.16
75 0.14
76 0.13
77 0.11
78 0.1
79 0.09
80 0.09
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.1
87 0.1
88 0.1
89 0.12
90 0.15
91 0.14
92 0.16
93 0.16
94 0.15
95 0.16
96 0.24
97 0.25
98 0.29
99 0.31
100 0.31
101 0.31
102 0.35
103 0.35
104 0.26
105 0.24
106 0.18
107 0.19
108 0.17
109 0.17
110 0.17
111 0.15
112 0.15
113 0.15
114 0.16
115 0.16
116 0.16
117 0.15
118 0.12
119 0.14
120 0.14
121 0.14
122 0.14
123 0.12
124 0.12
125 0.12
126 0.13
127 0.12
128 0.12
129 0.13
130 0.14
131 0.16
132 0.18
133 0.19
134 0.19
135 0.22
136 0.23
137 0.22
138 0.21
139 0.17
140 0.14
141 0.13
142 0.13
143 0.1
144 0.08
145 0.08
146 0.09
147 0.1
148 0.11
149 0.12
150 0.12
151 0.16
152 0.22
153 0.22
154 0.28
155 0.31
156 0.32
157 0.33
158 0.37
159 0.33
160 0.29
161 0.29
162 0.21
163 0.2
164 0.23
165 0.22
166 0.17
167 0.18
168 0.21
169 0.24
170 0.29
171 0.34
172 0.39
173 0.44
174 0.51
175 0.54
176 0.56
177 0.58
178 0.62
179 0.64
180 0.65
181 0.63
182 0.64
183 0.67
184 0.64
185 0.65
186 0.58
187 0.51
188 0.5
189 0.5
190 0.47
191 0.44
192 0.4
193 0.36
194 0.39
195 0.37
196 0.32
197 0.32
198 0.28
199 0.27
200 0.31
201 0.31
202 0.35
203 0.44
204 0.51
205 0.58
206 0.67
207 0.72
208 0.79
209 0.85
210 0.87
211 0.85
212 0.86
213 0.87
214 0.87
215 0.8
216 0.75
217 0.68
218 0.57
219 0.49
220 0.39
221 0.3
222 0.2
223 0.17
224 0.13
225 0.12
226 0.13