Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z3L4

Protein Details
Accession A0A4Z0Z3L4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
20-47AGAKDRRSKASSKRTRPAPRWWKIHLFRHydrophilic
NLS Segment(s)
PositionSequence
23-40KDRRSKASSKRTRPAPRW
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR011531  HCO3_transpt-like_TM_dom  
IPR003020  HCO3_transpt_euk  
Gene Ontology GO:0016020  C:membrane  
GO:0005452  F:solute:inorganic anion antiporter activity  
GO:0006820  P:monoatomic anion transport  
Pfam View protein in Pfam  
PF00955  HCO3_cotransp  
Amino Acid Sequences MTVTADTDPGPGSTSTTGGAGAKDRRSKASSKRTRPAPRWWKIHLFRGMVNDVRRRAPYYWSDWIDAWDYRVIPATVYMYFANILPALAFSLDMFTKTNMEYGVNEVLLASVLGAVVFSLIACQPLVVVGVTGPITVFNYTVYDIITPLGTNYLAFMCWIGLWAVLLHWILAITNSCNWLKYVTRFPCDIFGFYVAFIYLQKGIQVLERFGYGASFYLSLSVALLVFAIAYICGELGKAALFRHPVRIFLKDYGTPLTVIFFTGFVHLGRMKSVDLERLPTTRPFFPTADRPWLVELWDIEVKEVFLALPFAVLLTILFWFDHNVSSLIAQGTEFPLRKPAGFHWDIFLLGLTTGVAGILGLPFPNGLIPQAPFHTESLCVTVVEVDTDENNPETKGHHTYKRTHVVEQRVSNLAQGLLTLGTATGPLLIVLHLIPQAVLAGLFFIMGYQALEANGITLKLLYLLRDKNLTPANHPLGRIQRRGAVWAFVIVELVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.13
4 0.14
5 0.13
6 0.14
7 0.18
8 0.23
9 0.3
10 0.36
11 0.39
12 0.44
13 0.47
14 0.54
15 0.59
16 0.64
17 0.67
18 0.7
19 0.77
20 0.81
21 0.88
22 0.86
23 0.87
24 0.87
25 0.85
26 0.83
27 0.81
28 0.81
29 0.77
30 0.79
31 0.76
32 0.68
33 0.62
34 0.6
35 0.58
36 0.53
37 0.53
38 0.5
39 0.46
40 0.47
41 0.46
42 0.45
43 0.41
44 0.43
45 0.42
46 0.43
47 0.48
48 0.47
49 0.47
50 0.43
51 0.43
52 0.4
53 0.34
54 0.29
55 0.23
56 0.2
57 0.18
58 0.21
59 0.18
60 0.15
61 0.16
62 0.16
63 0.13
64 0.15
65 0.14
66 0.12
67 0.12
68 0.12
69 0.12
70 0.09
71 0.09
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.05
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.11
84 0.11
85 0.13
86 0.11
87 0.12
88 0.12
89 0.15
90 0.16
91 0.14
92 0.13
93 0.12
94 0.11
95 0.1
96 0.09
97 0.05
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.02
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.04
115 0.04
116 0.04
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.07
125 0.06
126 0.07
127 0.08
128 0.08
129 0.08
130 0.08
131 0.07
132 0.08
133 0.07
134 0.06
135 0.06
136 0.06
137 0.06
138 0.05
139 0.06
140 0.06
141 0.06
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.05
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.05
159 0.06
160 0.05
161 0.06
162 0.1
163 0.1
164 0.11
165 0.11
166 0.13
167 0.15
168 0.18
169 0.27
170 0.29
171 0.31
172 0.32
173 0.32
174 0.36
175 0.34
176 0.32
177 0.23
178 0.2
179 0.17
180 0.16
181 0.15
182 0.09
183 0.08
184 0.07
185 0.07
186 0.06
187 0.06
188 0.06
189 0.06
190 0.07
191 0.1
192 0.11
193 0.1
194 0.1
195 0.1
196 0.1
197 0.09
198 0.09
199 0.06
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.05
208 0.05
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.02
215 0.02
216 0.02
217 0.02
218 0.02
219 0.02
220 0.02
221 0.02
222 0.02
223 0.02
224 0.03
225 0.04
226 0.04
227 0.06
228 0.09
229 0.1
230 0.18
231 0.18
232 0.22
233 0.23
234 0.26
235 0.27
236 0.26
237 0.28
238 0.21
239 0.22
240 0.2
241 0.19
242 0.16
243 0.13
244 0.12
245 0.1
246 0.09
247 0.08
248 0.06
249 0.06
250 0.06
251 0.07
252 0.06
253 0.07
254 0.08
255 0.08
256 0.09
257 0.09
258 0.08
259 0.1
260 0.11
261 0.13
262 0.12
263 0.15
264 0.16
265 0.17
266 0.19
267 0.2
268 0.22
269 0.21
270 0.23
271 0.24
272 0.24
273 0.25
274 0.31
275 0.32
276 0.36
277 0.34
278 0.32
279 0.3
280 0.29
281 0.27
282 0.21
283 0.17
284 0.13
285 0.15
286 0.14
287 0.12
288 0.12
289 0.11
290 0.09
291 0.09
292 0.05
293 0.03
294 0.04
295 0.04
296 0.04
297 0.03
298 0.03
299 0.03
300 0.03
301 0.03
302 0.03
303 0.03
304 0.04
305 0.04
306 0.04
307 0.05
308 0.06
309 0.07
310 0.07
311 0.08
312 0.08
313 0.08
314 0.09
315 0.08
316 0.08
317 0.07
318 0.07
319 0.08
320 0.12
321 0.13
322 0.12
323 0.17
324 0.18
325 0.18
326 0.2
327 0.21
328 0.26
329 0.27
330 0.27
331 0.24
332 0.24
333 0.23
334 0.21
335 0.18
336 0.1
337 0.07
338 0.07
339 0.05
340 0.04
341 0.03
342 0.03
343 0.03
344 0.02
345 0.02
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.04
353 0.04
354 0.05
355 0.06
356 0.08
357 0.1
358 0.11
359 0.13
360 0.14
361 0.15
362 0.15
363 0.14
364 0.14
365 0.15
366 0.15
367 0.13
368 0.11
369 0.12
370 0.11
371 0.1
372 0.1
373 0.07
374 0.07
375 0.08
376 0.1
377 0.09
378 0.1
379 0.1
380 0.1
381 0.11
382 0.15
383 0.22
384 0.27
385 0.34
386 0.4
387 0.47
388 0.56
389 0.65
390 0.63
391 0.63
392 0.64
393 0.65
394 0.68
395 0.64
396 0.58
397 0.51
398 0.48
399 0.42
400 0.36
401 0.26
402 0.18
403 0.14
404 0.11
405 0.07
406 0.07
407 0.06
408 0.05
409 0.04
410 0.04
411 0.04
412 0.04
413 0.04
414 0.04
415 0.04
416 0.04
417 0.05
418 0.05
419 0.07
420 0.07
421 0.07
422 0.07
423 0.06
424 0.07
425 0.06
426 0.06
427 0.04
428 0.04
429 0.04
430 0.04
431 0.04
432 0.03
433 0.04
434 0.04
435 0.04
436 0.04
437 0.05
438 0.05
439 0.06
440 0.06
441 0.07
442 0.07
443 0.07
444 0.07
445 0.06
446 0.06
447 0.09
448 0.1
449 0.11
450 0.18
451 0.21
452 0.24
453 0.28
454 0.28
455 0.33
456 0.39
457 0.39
458 0.37
459 0.43
460 0.48
461 0.47
462 0.48
463 0.48
464 0.52
465 0.57
466 0.58
467 0.52
468 0.5
469 0.48
470 0.53
471 0.48
472 0.4
473 0.33
474 0.31
475 0.29
476 0.22