Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0Z8D8

Protein Details
Accession A0A4Z0Z8D8   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
5-27NRAGGKVKPLKAPKKQQKDLDDDHydrophilic
NLS Segment(s)
PositionSequence
12-17KPLKAP
69-86AAGKGPLASGGIKKSGKK
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MGGQNRAGGKVKPLKAPKKQQKDLDDDDVAHHEKLKAGKNFPTYGYFHLVQKTDERQDAKARAEMATKAAGKGPLASGGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.66
3 0.77
4 0.79
5 0.8
6 0.84
7 0.84
8 0.81
9 0.8
10 0.76
11 0.71
12 0.61
13 0.51
14 0.44
15 0.39
16 0.34
17 0.25
18 0.21
19 0.14
20 0.15
21 0.19
22 0.25
23 0.26
24 0.26
25 0.31
26 0.33
27 0.34
28 0.33
29 0.32
30 0.26
31 0.25
32 0.27
33 0.23
34 0.21
35 0.22
36 0.22
37 0.19
38 0.21
39 0.23
40 0.22
41 0.25
42 0.26
43 0.26
44 0.32
45 0.35
46 0.34
47 0.32
48 0.3
49 0.27
50 0.27
51 0.25
52 0.21
53 0.22
54 0.21
55 0.19
56 0.2
57 0.2
58 0.18
59 0.19
60 0.18
61 0.15
62 0.16
63 0.17
64 0.17
65 0.18
66 0.25