Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z0YTY0

Protein Details
Accession A0A4Z0YTY0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-31TPPSSPPVITTKKKRTRRLKTRVVAQRIGEHydrophilic
NLS Segment(s)
PositionSequence
13-21KKKRTRRLK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028005  AcTrfase_ESCO_Znf_dom  
Pfam View protein in Pfam  
PF13878  zf-C2H2_3  
Amino Acid Sequences MTPPSSPPVITTKKKRTRRLKTRVVAQRIGENEGSDEEQENQDSEKRKGRIRDIDPPAHARPPALSEATPNTLNQSEGTSRTRSEGGKSRENRRRESKTPSVQTTLSLSMSEVHYTECKECGMLYNHLHETDVKYHARRHASLRRAKARIDAKSDVVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.85
3 0.87
4 0.89
5 0.92
6 0.92
7 0.91
8 0.9
9 0.9
10 0.9
11 0.86
12 0.8
13 0.7
14 0.66
15 0.57
16 0.52
17 0.42
18 0.32
19 0.26
20 0.22
21 0.21
22 0.15
23 0.14
24 0.12
25 0.13
26 0.13
27 0.12
28 0.12
29 0.15
30 0.18
31 0.21
32 0.27
33 0.29
34 0.34
35 0.4
36 0.47
37 0.52
38 0.54
39 0.61
40 0.6
41 0.62
42 0.6
43 0.59
44 0.53
45 0.46
46 0.4
47 0.3
48 0.23
49 0.21
50 0.2
51 0.16
52 0.14
53 0.13
54 0.16
55 0.18
56 0.18
57 0.15
58 0.15
59 0.14
60 0.14
61 0.13
62 0.12
63 0.1
64 0.13
65 0.15
66 0.14
67 0.14
68 0.15
69 0.17
70 0.16
71 0.19
72 0.24
73 0.27
74 0.35
75 0.4
76 0.48
77 0.54
78 0.58
79 0.61
80 0.62
81 0.65
82 0.62
83 0.65
84 0.65
85 0.67
86 0.69
87 0.65
88 0.59
89 0.51
90 0.47
91 0.41
92 0.33
93 0.24
94 0.18
95 0.14
96 0.13
97 0.13
98 0.13
99 0.1
100 0.1
101 0.11
102 0.12
103 0.13
104 0.12
105 0.12
106 0.11
107 0.11
108 0.15
109 0.18
110 0.22
111 0.23
112 0.27
113 0.28
114 0.28
115 0.29
116 0.25
117 0.25
118 0.24
119 0.27
120 0.26
121 0.28
122 0.33
123 0.39
124 0.44
125 0.43
126 0.48
127 0.52
128 0.58
129 0.64
130 0.69
131 0.72
132 0.69
133 0.68
134 0.68
135 0.67
136 0.65
137 0.63
138 0.57