Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z0YPR9

Protein Details
Accession A0A4Z0YPR9    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-25PQDPNLYGRRPAKKQKREIPLSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Amino Acid Sequences MPQDPNLYGRRPAKKQKREIPLSSSLAFTSQLSSLISAPETTSSPSSRGGGSSSARPRSSKTKDDIFSVKAKQKQPGPSSRSDRDGPDDSSSRIRLKHVHNTEEEKQDFARARRKMEEKARLYAAMKRGDYVAKDNEAAPLVDFDRKWAERHPEDEEERYSSSGSDNESSDDGRAGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.84
3 0.85
4 0.87
5 0.87
6 0.84
7 0.79
8 0.76
9 0.71
10 0.61
11 0.52
12 0.42
13 0.34
14 0.29
15 0.22
16 0.16
17 0.11
18 0.11
19 0.11
20 0.11
21 0.11
22 0.11
23 0.11
24 0.09
25 0.09
26 0.09
27 0.1
28 0.11
29 0.13
30 0.13
31 0.15
32 0.16
33 0.17
34 0.16
35 0.15
36 0.15
37 0.16
38 0.17
39 0.23
40 0.28
41 0.32
42 0.33
43 0.34
44 0.36
45 0.42
46 0.47
47 0.45
48 0.44
49 0.47
50 0.47
51 0.5
52 0.5
53 0.43
54 0.41
55 0.4
56 0.41
57 0.39
58 0.4
59 0.41
60 0.43
61 0.48
62 0.5
63 0.54
64 0.53
65 0.54
66 0.58
67 0.56
68 0.54
69 0.48
70 0.43
71 0.39
72 0.37
73 0.31
74 0.27
75 0.26
76 0.23
77 0.24
78 0.25
79 0.21
80 0.19
81 0.19
82 0.22
83 0.26
84 0.34
85 0.36
86 0.37
87 0.39
88 0.45
89 0.47
90 0.48
91 0.44
92 0.35
93 0.31
94 0.31
95 0.32
96 0.29
97 0.33
98 0.29
99 0.33
100 0.38
101 0.43
102 0.46
103 0.52
104 0.58
105 0.53
106 0.55
107 0.53
108 0.48
109 0.46
110 0.42
111 0.39
112 0.35
113 0.31
114 0.27
115 0.27
116 0.26
117 0.27
118 0.27
119 0.24
120 0.2
121 0.21
122 0.21
123 0.21
124 0.2
125 0.18
126 0.14
127 0.12
128 0.12
129 0.15
130 0.14
131 0.15
132 0.22
133 0.23
134 0.24
135 0.29
136 0.37
137 0.38
138 0.42
139 0.46
140 0.46
141 0.49
142 0.52
143 0.48
144 0.43
145 0.4
146 0.36
147 0.3
148 0.23
149 0.21
150 0.19
151 0.19
152 0.18
153 0.17
154 0.19
155 0.2
156 0.21
157 0.19