Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MKW5

Protein Details
Accession G9MKW5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
290-309SVYVKRYKWAWLKSRKITYDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR036909  Cyt_c-like_dom_sf  
IPR002326  Cyt_c1  
IPR021157  Cyt_c1_TM_anchor_C  
Gene Ontology GO:0005750  C:mitochondrial respiratory chain complex III  
GO:0020037  F:heme binding  
GO:0008121  F:ubiquinol-cytochrome-c reductase activity  
GO:0006122  P:mitochondrial electron transport, ubiquinol to cytochrome c  
Pfam View protein in Pfam  
PF02167  Cytochrom_C1  
Amino Acid Sequences MLARSTLRPARVLNGLRNGAVNVSKRAASTSSEASPARLNFAAIASTTLAAGSMAWYYHLYGPVAFASSPAEEGLHATQYPWVHQQFFKTFDHQALRRGFQVYREVCASCHSLSRVPYRALVGTVLTVDEAKALAEENEYPDEPDEQGEIPMRPGKLADYIPPPYKNDEAARFANNGALPPDLSLIVKARHGGCDYIFSLLTGYPEEPPAGVQVAPGMNFNPYFPGTGIGMARVLYDGLVEYEDGTPASTSQMAKDVVEFLNWAAEPEMDERKKMGMKVLVATTALWAISVYVKRYKWAWLKSRKITYDPPAETKVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.43
4 0.42
5 0.38
6 0.32
7 0.33
8 0.29
9 0.24
10 0.24
11 0.25
12 0.24
13 0.26
14 0.25
15 0.23
16 0.24
17 0.25
18 0.24
19 0.28
20 0.28
21 0.27
22 0.31
23 0.28
24 0.28
25 0.24
26 0.22
27 0.18
28 0.18
29 0.17
30 0.12
31 0.13
32 0.1
33 0.09
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.08
45 0.11
46 0.12
47 0.12
48 0.12
49 0.13
50 0.12
51 0.13
52 0.11
53 0.09
54 0.1
55 0.09
56 0.1
57 0.09
58 0.09
59 0.07
60 0.1
61 0.1
62 0.1
63 0.1
64 0.09
65 0.13
66 0.13
67 0.15
68 0.19
69 0.2
70 0.21
71 0.23
72 0.28
73 0.29
74 0.33
75 0.33
76 0.31
77 0.3
78 0.32
79 0.38
80 0.34
81 0.37
82 0.37
83 0.36
84 0.35
85 0.36
86 0.31
87 0.28
88 0.35
89 0.29
90 0.27
91 0.28
92 0.26
93 0.23
94 0.25
95 0.24
96 0.16
97 0.17
98 0.17
99 0.18
100 0.21
101 0.26
102 0.27
103 0.26
104 0.26
105 0.25
106 0.24
107 0.22
108 0.19
109 0.13
110 0.1
111 0.09
112 0.07
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.07
125 0.08
126 0.08
127 0.09
128 0.09
129 0.1
130 0.09
131 0.09
132 0.08
133 0.07
134 0.08
135 0.09
136 0.08
137 0.09
138 0.11
139 0.11
140 0.1
141 0.1
142 0.1
143 0.11
144 0.12
145 0.13
146 0.15
147 0.18
148 0.21
149 0.23
150 0.23
151 0.23
152 0.24
153 0.24
154 0.23
155 0.23
156 0.24
157 0.25
158 0.25
159 0.23
160 0.22
161 0.22
162 0.18
163 0.15
164 0.12
165 0.1
166 0.08
167 0.08
168 0.08
169 0.07
170 0.06
171 0.07
172 0.08
173 0.08
174 0.09
175 0.11
176 0.11
177 0.13
178 0.14
179 0.14
180 0.12
181 0.15
182 0.15
183 0.14
184 0.13
185 0.11
186 0.11
187 0.1
188 0.11
189 0.08
190 0.08
191 0.07
192 0.08
193 0.08
194 0.07
195 0.07
196 0.08
197 0.08
198 0.07
199 0.06
200 0.08
201 0.08
202 0.09
203 0.09
204 0.08
205 0.09
206 0.09
207 0.09
208 0.1
209 0.1
210 0.11
211 0.1
212 0.12
213 0.11
214 0.13
215 0.13
216 0.11
217 0.11
218 0.09
219 0.09
220 0.07
221 0.07
222 0.05
223 0.05
224 0.04
225 0.04
226 0.05
227 0.05
228 0.06
229 0.06
230 0.07
231 0.06
232 0.07
233 0.06
234 0.06
235 0.08
236 0.09
237 0.09
238 0.1
239 0.14
240 0.15
241 0.15
242 0.15
243 0.17
244 0.15
245 0.15
246 0.15
247 0.1
248 0.13
249 0.13
250 0.12
251 0.1
252 0.1
253 0.11
254 0.14
255 0.23
256 0.21
257 0.22
258 0.22
259 0.26
260 0.29
261 0.29
262 0.32
263 0.27
264 0.29
265 0.33
266 0.33
267 0.3
268 0.27
269 0.26
270 0.2
271 0.16
272 0.13
273 0.09
274 0.07
275 0.07
276 0.12
277 0.14
278 0.17
279 0.23
280 0.24
281 0.26
282 0.28
283 0.36
284 0.4
285 0.48
286 0.54
287 0.59
288 0.69
289 0.76
290 0.84
291 0.8
292 0.77
293 0.76
294 0.75
295 0.74
296 0.69
297 0.66
298 0.62