Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8M6M9

Protein Details
Accession A0A4S8M6M9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-36EIPLLFFKPSRRPKRPKLIQLDVSDHydrophilic
NLS Segment(s)
PositionSequence
22-26RRPKR
Subcellular Location(s) nucl 13.5, mito_nucl 10.666, cyto_nucl 9.333, mito 6.5, cyto 3
Family & Domain DBs
CDD cd09917  F-box_SF  
Amino Acid Sequences MFTMFFPSSSNEIPLLFFKPSRRPKRPKLIQLDVSDLPKPLSVFAGGIPPHCPQEVIELIFKNLDQPSDLLHVISTSRLFCNIGLPVLYRSIEYVGPDDLESNKSFWGLSHMHTRTKAHSMTVTGPTRCAMVDSYYIYKNDSWHHRPNWTLEELITLNRHLLQLTELDLSHLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.19
4 0.2
5 0.23
6 0.33
7 0.44
8 0.53
9 0.61
10 0.68
11 0.76
12 0.85
13 0.9
14 0.9
15 0.89
16 0.88
17 0.85
18 0.78
19 0.74
20 0.65
21 0.57
22 0.48
23 0.38
24 0.29
25 0.23
26 0.2
27 0.14
28 0.12
29 0.1
30 0.09
31 0.09
32 0.14
33 0.13
34 0.14
35 0.16
36 0.16
37 0.17
38 0.16
39 0.16
40 0.11
41 0.16
42 0.18
43 0.18
44 0.19
45 0.18
46 0.19
47 0.18
48 0.18
49 0.15
50 0.13
51 0.11
52 0.09
53 0.08
54 0.1
55 0.12
56 0.13
57 0.1
58 0.09
59 0.09
60 0.09
61 0.09
62 0.09
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.1
88 0.1
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.12
95 0.11
96 0.13
97 0.22
98 0.24
99 0.27
100 0.29
101 0.31
102 0.29
103 0.34
104 0.32
105 0.24
106 0.24
107 0.24
108 0.25
109 0.32
110 0.33
111 0.28
112 0.28
113 0.27
114 0.25
115 0.23
116 0.2
117 0.13
118 0.1
119 0.13
120 0.15
121 0.18
122 0.2
123 0.2
124 0.21
125 0.21
126 0.21
127 0.25
128 0.32
129 0.35
130 0.42
131 0.46
132 0.5
133 0.52
134 0.55
135 0.54
136 0.47
137 0.41
138 0.32
139 0.32
140 0.28
141 0.28
142 0.24
143 0.19
144 0.17
145 0.18
146 0.18
147 0.13
148 0.13
149 0.12
150 0.11
151 0.14
152 0.14
153 0.13