Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9N5S4

Protein Details
Accession G9N5S4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-55MGDGGRRWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWRWKMEVEDGHydrophilic
NLS Segment(s)
PositionSequence
5-49GRRWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWRWK
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGDGGRRWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWKWRWKMEVEDGGGRWKWKMEVAVEVEVLGKKVNWKINTCTSFLAYENSGSLQSRRQREGKRVLFWPEASTVNATGIKFMQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.94
3 0.95
4 0.96
5 0.96
6 0.97
7 0.96
8 0.96
9 0.96
10 0.96
11 0.96
12 0.96
13 0.96
14 0.96
15 0.96
16 0.96
17 0.96
18 0.96
19 0.96
20 0.96
21 0.96
22 0.96
23 0.96
24 0.96
25 0.96
26 0.96
27 0.96
28 0.96
29 0.96
30 0.96
31 0.95
32 0.95
33 0.92
34 0.9
35 0.84
36 0.81
37 0.76
38 0.7
39 0.61
40 0.52
41 0.44
42 0.37
43 0.32
44 0.24
45 0.18
46 0.13
47 0.11
48 0.1
49 0.11
50 0.09
51 0.13
52 0.15
53 0.15
54 0.15
55 0.14
56 0.14
57 0.12
58 0.12
59 0.08
60 0.06
61 0.07
62 0.12
63 0.18
64 0.2
65 0.23
66 0.28
67 0.37
68 0.4
69 0.39
70 0.36
71 0.32
72 0.3
73 0.27
74 0.24
75 0.16
76 0.14
77 0.13
78 0.12
79 0.12
80 0.11
81 0.12
82 0.17
83 0.23
84 0.28
85 0.33
86 0.41
87 0.47
88 0.55
89 0.65
90 0.65
91 0.64
92 0.64
93 0.65
94 0.61
95 0.56
96 0.49
97 0.42
98 0.35
99 0.31
100 0.28
101 0.22
102 0.21
103 0.23
104 0.2
105 0.19