Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8M497

Protein Details
Accession A0A4S8M497    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MDDLKGGPKKRKISREKAFGIBasic
NLS Segment(s)
PositionSequence
7-15GPKKRKISR
Subcellular Location(s) mito 16.5, cyto_mito 12.333, cyto 7, cyto_nucl 5.833
Family & Domain DBs
Amino Acid Sequences MDDLKGGPKKRKISREKAFGIAFPGVPYKASTFTKAYHAYELGRQNRIIYKQFMEADREEAGLWSGFVKHVTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.79
4 0.76
5 0.68
6 0.58
7 0.51
8 0.41
9 0.32
10 0.23
11 0.2
12 0.13
13 0.13
14 0.13
15 0.11
16 0.14
17 0.15
18 0.17
19 0.17
20 0.18
21 0.23
22 0.25
23 0.25
24 0.22
25 0.21
26 0.19
27 0.23
28 0.29
29 0.27
30 0.27
31 0.26
32 0.26
33 0.3
34 0.33
35 0.31
36 0.26
37 0.25
38 0.28
39 0.31
40 0.31
41 0.31
42 0.28
43 0.28
44 0.25
45 0.24
46 0.19
47 0.16
48 0.15
49 0.11
50 0.1
51 0.08
52 0.08
53 0.09