Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LU23

Protein Details
Accession A0A4S8LU23    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
96-116NPCTDWKCRPHVKVRFQPNGHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto 8.5, cyto_pero 6, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR003653  Peptidase_C48_C  
Gene Ontology GO:0008234  F:cysteine-type peptidase activity  
GO:0019783  F:ubiquitin-like protein peptidase activity  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF02902  Peptidase_C48  
PROSITE View protein in PROSITE  
PS50600  ULP_PROTEASE  
Amino Acid Sequences MGSAYSGYKPRQKVLGLRQWHQVFIPINEGRNHWYAACIDFHQKTIDVYDSLEPTLRLNQDKPIGERKYAGLMLALMWVTEVVGSLRGDTVQLANNPCTDWKCRPHVKVRFQPNGHDCGIRAWLSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.57
3 0.57
4 0.57
5 0.63
6 0.58
7 0.55
8 0.46
9 0.42
10 0.35
11 0.3
12 0.35
13 0.27
14 0.29
15 0.29
16 0.3
17 0.28
18 0.27
19 0.26
20 0.18
21 0.18
22 0.16
23 0.17
24 0.17
25 0.15
26 0.18
27 0.18
28 0.19
29 0.18
30 0.18
31 0.16
32 0.16
33 0.16
34 0.11
35 0.12
36 0.12
37 0.12
38 0.12
39 0.12
40 0.1
41 0.1
42 0.13
43 0.13
44 0.13
45 0.13
46 0.17
47 0.21
48 0.22
49 0.24
50 0.29
51 0.29
52 0.28
53 0.28
54 0.25
55 0.23
56 0.22
57 0.19
58 0.11
59 0.09
60 0.09
61 0.08
62 0.07
63 0.04
64 0.04
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.08
78 0.09
79 0.12
80 0.15
81 0.16
82 0.16
83 0.17
84 0.19
85 0.2
86 0.23
87 0.26
88 0.3
89 0.39
90 0.47
91 0.54
92 0.62
93 0.69
94 0.75
95 0.77
96 0.81
97 0.82
98 0.75
99 0.78
100 0.72
101 0.68
102 0.59
103 0.51
104 0.41
105 0.35
106 0.37
107 0.28