Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LCM1

Protein Details
Accession A0A4S8LCM1   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAKTKKKKLNRKSKFFLDSDHydrophilic
NLS Segment(s)
PositionSequence
5-12KKKKLNRK
Subcellular Location(s) nucl 12, mito 9, plas 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAKTKKKKLNRKSKFFLDSDPMYSNAILVRLVFQSLLEKLKQRQKTLVSHNDVDMSKVEDPEHILSLSQTPDSMLVLVCFVGNVPLVVEVIFGGLTAIDISSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.77
3 0.71
4 0.67
5 0.59
6 0.53
7 0.46
8 0.37
9 0.31
10 0.29
11 0.23
12 0.16
13 0.14
14 0.1
15 0.08
16 0.08
17 0.07
18 0.08
19 0.07
20 0.07
21 0.08
22 0.1
23 0.12
24 0.12
25 0.14
26 0.2
27 0.28
28 0.33
29 0.33
30 0.37
31 0.4
32 0.45
33 0.51
34 0.54
35 0.51
36 0.47
37 0.45
38 0.43
39 0.37
40 0.31
41 0.23
42 0.17
43 0.13
44 0.13
45 0.12
46 0.09
47 0.12
48 0.12
49 0.13
50 0.1
51 0.09
52 0.09
53 0.11
54 0.11
55 0.09
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.06
62 0.05
63 0.05
64 0.06
65 0.05
66 0.05
67 0.04
68 0.05
69 0.05
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.04
81 0.03
82 0.04
83 0.04