Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LDD1

Protein Details
Accession A0A4S8LDD1   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
73-93EAGIPIRKRRTERSDKGKKHQBasic
NLS Segment(s)
PositionSequence
77-93PIRKRRTERSDKGKKHQ
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
Amino Acid Sequences MDYTNFEVNIVAVQGVHIVGWPEHIPFKTPSAMTTSQHINDIYNSWQEGKAHWARLTPAELNKLNRRLQRDEEAGIPIRKRRTERSDKGKKHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.08
8 0.08
9 0.09
10 0.12
11 0.13
12 0.15
13 0.16
14 0.18
15 0.2
16 0.19
17 0.19
18 0.22
19 0.25
20 0.22
21 0.24
22 0.24
23 0.22
24 0.23
25 0.23
26 0.17
27 0.15
28 0.15
29 0.14
30 0.11
31 0.11
32 0.1
33 0.11
34 0.11
35 0.11
36 0.16
37 0.17
38 0.19
39 0.19
40 0.19
41 0.19
42 0.21
43 0.24
44 0.2
45 0.19
46 0.23
47 0.25
48 0.3
49 0.36
50 0.4
51 0.43
52 0.44
53 0.48
54 0.48
55 0.5
56 0.52
57 0.49
58 0.45
59 0.41
60 0.41
61 0.4
62 0.38
63 0.36
64 0.34
65 0.37
66 0.41
67 0.44
68 0.49
69 0.55
70 0.62
71 0.7
72 0.76
73 0.81