Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MM95

Protein Details
Accession G9MM95    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
115-138RASRADKAVKKEPKKEPKEEYDSSBasic
NLS Segment(s)
PositionSequence
78-101KRKPAGGDGGSAKKKAKATKKEES
105-132IKDTKLAPKTRASRADKAVKKEPKKEPK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.833, cyto 10, cyto_mito 5.833
Family & Domain DBs
Amino Acid Sequences MSKQDPAEQVRFLVSCIGHTTNGRPDFTLVAQELGIVSKAAAQKRYERMLKANGVNASKPAAKSGADDENTPVSTPVKRKPAGGDGGSAKKKAKATKKEESDDDIKDTKLAPKTRASRADKAVKKEPKKEPKEEYDSSLSGTLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.19
4 0.2
5 0.19
6 0.2
7 0.24
8 0.28
9 0.32
10 0.31
11 0.28
12 0.27
13 0.27
14 0.27
15 0.27
16 0.18
17 0.16
18 0.15
19 0.14
20 0.12
21 0.1
22 0.1
23 0.06
24 0.05
25 0.08
26 0.12
27 0.14
28 0.18
29 0.19
30 0.25
31 0.31
32 0.38
33 0.38
34 0.37
35 0.39
36 0.42
37 0.45
38 0.41
39 0.4
40 0.37
41 0.34
42 0.32
43 0.28
44 0.24
45 0.21
46 0.19
47 0.15
48 0.13
49 0.12
50 0.13
51 0.15
52 0.18
53 0.17
54 0.17
55 0.18
56 0.18
57 0.18
58 0.17
59 0.14
60 0.09
61 0.12
62 0.15
63 0.19
64 0.24
65 0.25
66 0.26
67 0.29
68 0.33
69 0.35
70 0.32
71 0.3
72 0.26
73 0.33
74 0.33
75 0.32
76 0.27
77 0.26
78 0.3
79 0.34
80 0.41
81 0.44
82 0.5
83 0.59
84 0.66
85 0.66
86 0.65
87 0.63
88 0.58
89 0.49
90 0.46
91 0.38
92 0.3
93 0.26
94 0.25
95 0.25
96 0.28
97 0.29
98 0.28
99 0.35
100 0.42
101 0.49
102 0.58
103 0.59
104 0.59
105 0.64
106 0.71
107 0.68
108 0.69
109 0.71
110 0.72
111 0.73
112 0.75
113 0.78
114 0.78
115 0.81
116 0.83
117 0.81
118 0.81
119 0.81
120 0.75
121 0.7
122 0.65
123 0.57
124 0.51
125 0.43