Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MSY2

Protein Details
Accession A0A4S8MSY2    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-78KVEAQEKKKTPKGRAKNRRLKCYQMCCQTHHHHPKCRPKCCQRLHRKQRKHALKRKTWVACGHydrophilic
NLS Segment(s)
PositionSequence
17-35KVEAQEKKKTPKGRAKNRR
62-71RKQRKHALKR
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences VHGSLARAGKVKSQTPKVEAQEKKKTPKGRAKNRRLKCYQMCCQTHHHHPKCRPKCCQRLHRKQRKHALKRKTWVACG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.56
4 0.56
5 0.6
6 0.6
7 0.61
8 0.63
9 0.65
10 0.69
11 0.69
12 0.7
13 0.7
14 0.74
15 0.76
16 0.76
17 0.81
18 0.84
19 0.87
20 0.88
21 0.88
22 0.82
23 0.8
24 0.77
25 0.74
26 0.71
27 0.7
28 0.64
29 0.57
30 0.6
31 0.56
32 0.58
33 0.61
34 0.61
35 0.6
36 0.67
37 0.75
38 0.78
39 0.82
40 0.82
41 0.81
42 0.84
43 0.85
44 0.87
45 0.87
46 0.89
47 0.92
48 0.93
49 0.93
50 0.93
51 0.94
52 0.94
53 0.94
54 0.92
55 0.91
56 0.9
57 0.89
58 0.89