Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LU92

Protein Details
Accession A0A4S8LU92    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-66QPGPSAPKGKKCKAKEKSSKRPKRRRRRGEESDEAEWBasic
93-162SNAGKGKGKKKGKEKEKEKERDRERGKGKGKGKEKEKEKEKEKEKEKEKEKEKGKRKGKETEHTRPRSTRBasic
NLS Segment(s)
PositionSequence
35-58APKGKKCKAKEKSSKRPKRRRRRG
96-162GKGKGKKKGKEKEKEKERDRERGKGKGKGKEKEKEKEKEKEKEKEKEKEKGKRKGKETEHTRPRSTR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences YSGAIPCEDSEDTPIPYSPSPSPPPDVESQPGPSAPKGKKCKAKEKSSKRPKRRRRRGEESDEAEWTGVSEGEEEDFGDDTGETTEEDEDELSNAGKGKGKKKGKEKEKEKERDRERGKGKGKGKEKEKEKEKEKEKEKEKEKEKGKRKGKETEHTRPRSTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.25
5 0.22
6 0.27
7 0.3
8 0.32
9 0.36
10 0.34
11 0.38
12 0.38
13 0.39
14 0.35
15 0.33
16 0.33
17 0.3
18 0.3
19 0.27
20 0.25
21 0.3
22 0.31
23 0.38
24 0.44
25 0.5
26 0.58
27 0.64
28 0.73
29 0.74
30 0.81
31 0.82
32 0.85
33 0.88
34 0.89
35 0.93
36 0.93
37 0.95
38 0.95
39 0.95
40 0.95
41 0.95
42 0.94
43 0.94
44 0.92
45 0.91
46 0.89
47 0.83
48 0.73
49 0.63
50 0.53
51 0.42
52 0.31
53 0.22
54 0.13
55 0.07
56 0.05
57 0.04
58 0.04
59 0.04
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.1
84 0.14
85 0.2
86 0.29
87 0.37
88 0.44
89 0.54
90 0.63
91 0.7
92 0.77
93 0.81
94 0.82
95 0.85
96 0.88
97 0.85
98 0.86
99 0.81
100 0.81
101 0.76
102 0.75
103 0.69
104 0.69
105 0.68
106 0.67
107 0.68
108 0.67
109 0.71
110 0.7
111 0.74
112 0.73
113 0.75
114 0.76
115 0.78
116 0.79
117 0.78
118 0.8
119 0.8
120 0.81
121 0.82
122 0.81
123 0.81
124 0.81
125 0.82
126 0.82
127 0.81
128 0.8
129 0.81
130 0.82
131 0.83
132 0.84
133 0.84
134 0.84
135 0.83
136 0.84
137 0.83
138 0.84
139 0.83
140 0.84
141 0.85
142 0.83