Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G9N4M9

Protein Details
Accession G9N4M9    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-29RLPPLKTLRVHNPKRQPENPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 10.5, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MSGGAKAIRLPPLKTLRVHNPKRQPENPCIAIMSSVLACWASAGYNAAGCAAIENQLRKCMDGPAPPPAPANTINYHLSRMQKYVTSPRKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.48
3 0.51
4 0.59
5 0.65
6 0.67
7 0.69
8 0.75
9 0.81
10 0.81
11 0.76
12 0.73
13 0.73
14 0.65
15 0.56
16 0.47
17 0.37
18 0.31
19 0.24
20 0.18
21 0.09
22 0.07
23 0.06
24 0.05
25 0.05
26 0.04
27 0.04
28 0.03
29 0.03
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.07
40 0.08
41 0.11
42 0.11
43 0.16
44 0.16
45 0.16
46 0.17
47 0.18
48 0.2
49 0.24
50 0.26
51 0.29
52 0.31
53 0.31
54 0.32
55 0.28
56 0.28
57 0.25
58 0.26
59 0.21
60 0.23
61 0.26
62 0.25
63 0.28
64 0.28
65 0.33
66 0.31
67 0.31
68 0.29
69 0.29
70 0.34
71 0.42
72 0.48