Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MUG9

Protein Details
Accession A0A4S8MUG9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
58-83ECCSSFKMIVGRRRRRRRRNRQSGTHHydrophilic
NLS Segment(s)
PositionSequence
68-79GRRRRRRRRNRQ
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MEDTSEKRDSGTNLKKSLQSSLENHDHHHVKLREVDTAATLLVTVEMSILQRLPGCCECCSSFKMIVGRRRRRRRRNRQSGTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.49
4 0.5
5 0.44
6 0.4
7 0.36
8 0.39
9 0.44
10 0.41
11 0.41
12 0.42
13 0.39
14 0.34
15 0.41
16 0.34
17 0.28
18 0.34
19 0.33
20 0.29
21 0.27
22 0.27
23 0.18
24 0.17
25 0.15
26 0.08
27 0.07
28 0.05
29 0.04
30 0.04
31 0.03
32 0.02
33 0.03
34 0.03
35 0.04
36 0.04
37 0.04
38 0.06
39 0.07
40 0.11
41 0.15
42 0.18
43 0.18
44 0.22
45 0.24
46 0.25
47 0.26
48 0.26
49 0.23
50 0.25
51 0.32
52 0.35
53 0.42
54 0.5
55 0.59
56 0.66
57 0.76
58 0.83
59 0.88
60 0.92
61 0.95
62 0.96
63 0.96