Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9MYJ7

Protein Details
Accession G9MYJ7    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
134-159DAEQATNRKTKKKAKKIKLSFDEDEGHydrophilic
NLS Segment(s)
PositionSequence
101-102KR
141-151RKTKKKAKKIK
Subcellular Location(s) nucl 17.5, mito_nucl 12.5, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MSQKINSKNLSYNSSLPPFLAALRAQASGASGPDPILSAQRRSGKKRSSSEEAEDVPLVVDENGNTIEDLKGAEDGTLETEQNKTNKAESEPTKASIGGRKRKVGKVIGEDAQNDAVEPSAEKKPDAAKKSTDDAEQATNRKTKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.34
4 0.31
5 0.26
6 0.22
7 0.2
8 0.14
9 0.14
10 0.15
11 0.15
12 0.14
13 0.13
14 0.14
15 0.11
16 0.12
17 0.09
18 0.08
19 0.07
20 0.07
21 0.08
22 0.07
23 0.13
24 0.14
25 0.16
26 0.22
27 0.3
28 0.36
29 0.42
30 0.51
31 0.52
32 0.59
33 0.65
34 0.66
35 0.65
36 0.64
37 0.61
38 0.57
39 0.5
40 0.43
41 0.36
42 0.28
43 0.21
44 0.16
45 0.12
46 0.07
47 0.06
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.1
69 0.11
70 0.13
71 0.12
72 0.13
73 0.15
74 0.16
75 0.22
76 0.23
77 0.29
78 0.29
79 0.3
80 0.29
81 0.27
82 0.27
83 0.26
84 0.31
85 0.33
86 0.36
87 0.41
88 0.46
89 0.49
90 0.54
91 0.53
92 0.5
93 0.47
94 0.48
95 0.45
96 0.41
97 0.38
98 0.33
99 0.29
100 0.23
101 0.17
102 0.12
103 0.09
104 0.07
105 0.07
106 0.09
107 0.12
108 0.13
109 0.13
110 0.16
111 0.24
112 0.32
113 0.37
114 0.37
115 0.38
116 0.42
117 0.47
118 0.47
119 0.41
120 0.35
121 0.32
122 0.36
123 0.36
124 0.36
125 0.35
126 0.38
127 0.4
128 0.46
129 0.52
130 0.56
131 0.62
132 0.69
133 0.76
134 0.81
135 0.89
136 0.92
137 0.94
138 0.92
139 0.9