Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L7G5

Protein Details
Accession A0A4S8L7G5   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-99GSVPPAGKRPRGRPRGSRNKKSLGEDBasic
NLS Segment(s)
PositionSequence
78-94PAGKRPRGRPRGSRNKK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR000637  HMGI/Y_DNA-bd_CS  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00354  HMGI_Y  
Amino Acid Sequences MSNHDPPSYVRRYLNERRLNGQSIPTASTASTAAPSSPSTSIIPTTTITSSTSFSVPITPATHKRTATEELAGGSVPPAGKRPRGRPRGSRNKKSLGEDGGGANAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.62
3 0.6
4 0.61
5 0.63
6 0.61
7 0.54
8 0.47
9 0.4
10 0.33
11 0.31
12 0.26
13 0.22
14 0.18
15 0.17
16 0.14
17 0.11
18 0.1
19 0.08
20 0.08
21 0.09
22 0.09
23 0.11
24 0.11
25 0.12
26 0.12
27 0.13
28 0.13
29 0.12
30 0.13
31 0.12
32 0.13
33 0.11
34 0.11
35 0.11
36 0.11
37 0.12
38 0.12
39 0.11
40 0.1
41 0.1
42 0.1
43 0.09
44 0.1
45 0.11
46 0.13
47 0.18
48 0.23
49 0.27
50 0.26
51 0.28
52 0.3
53 0.32
54 0.31
55 0.26
56 0.22
57 0.18
58 0.18
59 0.16
60 0.12
61 0.08
62 0.08
63 0.07
64 0.07
65 0.11
66 0.14
67 0.22
68 0.29
69 0.39
70 0.49
71 0.58
72 0.66
73 0.72
74 0.8
75 0.84
76 0.88
77 0.88
78 0.86
79 0.86
80 0.84
81 0.79
82 0.75
83 0.68
84 0.59
85 0.5
86 0.43