Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MXJ8

Protein Details
Accession A0A4S8MXJ8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
21-40IKCIKTCKPAFQRWKKTKVLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, mito 9, cyto_nucl 8, cysk 3
Family & Domain DBs
Amino Acid Sequences GMTIHSWGAVSPVAQDIDSVIKCIKTCKPAFQRWKKTKVLIIDEGFWVISCYPRTRLIVYVCVTSFYGGRSLLLAVSGNRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.14
5 0.14
6 0.14
7 0.13
8 0.13
9 0.14
10 0.18
11 0.21
12 0.25
13 0.27
14 0.35
15 0.43
16 0.52
17 0.62
18 0.69
19 0.76
20 0.76
21 0.82
22 0.76
23 0.71
24 0.65
25 0.6
26 0.54
27 0.48
28 0.41
29 0.34
30 0.3
31 0.27
32 0.23
33 0.17
34 0.12
35 0.06
36 0.08
37 0.08
38 0.1
39 0.13
40 0.16
41 0.19
42 0.2
43 0.24
44 0.25
45 0.29
46 0.29
47 0.3
48 0.26
49 0.26
50 0.24
51 0.21
52 0.18
53 0.13
54 0.14
55 0.11
56 0.11
57 0.1
58 0.1
59 0.09
60 0.1
61 0.11