Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8L4S1

Protein Details
Accession A0A4S8L4S1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-73GKGKEKEKEKEKQSHKRQPQHIYIFBasic
NLS Segment(s)
PositionSequence
49-67GKGKEKEKEKEKQSHKRQP
75-89EKEKEKEKEGKEKEK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.833, cyto 7, cyto_pero 4.333
Family & Domain DBs
Amino Acid Sequences MANFAEMKKDDFEQENIQAQSRALQRKILGHASQQKARVDNAPKELVSGKGKEKEKEKEKQSHKRQPQHIYIFSEKEKEKEKEGKEKEKEVLRKLTHQAAHAVKSTEYVEDIDNKDTAMDVNPVPTDPASTDLVPTNPIPTAQSNEDLSIPDKATPILLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.36
3 0.35
4 0.35
5 0.31
6 0.28
7 0.3
8 0.32
9 0.35
10 0.3
11 0.32
12 0.33
13 0.38
14 0.43
15 0.43
16 0.37
17 0.38
18 0.47
19 0.49
20 0.51
21 0.51
22 0.49
23 0.44
24 0.44
25 0.44
26 0.41
27 0.4
28 0.41
29 0.39
30 0.36
31 0.36
32 0.35
33 0.32
34 0.28
35 0.27
36 0.26
37 0.31
38 0.35
39 0.37
40 0.43
41 0.48
42 0.52
43 0.58
44 0.6
45 0.63
46 0.69
47 0.76
48 0.8
49 0.81
50 0.83
51 0.84
52 0.85
53 0.82
54 0.81
55 0.77
56 0.71
57 0.65
58 0.58
59 0.52
60 0.45
61 0.42
62 0.33
63 0.29
64 0.31
65 0.27
66 0.29
67 0.34
68 0.37
69 0.42
70 0.48
71 0.55
72 0.52
73 0.54
74 0.54
75 0.53
76 0.54
77 0.48
78 0.5
79 0.42
80 0.44
81 0.43
82 0.45
83 0.4
84 0.36
85 0.38
86 0.32
87 0.32
88 0.29
89 0.27
90 0.21
91 0.21
92 0.2
93 0.14
94 0.13
95 0.11
96 0.1
97 0.14
98 0.15
99 0.15
100 0.15
101 0.14
102 0.13
103 0.12
104 0.12
105 0.09
106 0.1
107 0.08
108 0.1
109 0.1
110 0.11
111 0.12
112 0.11
113 0.11
114 0.09
115 0.12
116 0.13
117 0.13
118 0.15
119 0.15
120 0.16
121 0.17
122 0.17
123 0.15
124 0.13
125 0.13
126 0.15
127 0.16
128 0.2
129 0.21
130 0.24
131 0.24
132 0.25
133 0.25
134 0.24
135 0.24
136 0.22
137 0.2
138 0.18
139 0.17
140 0.16
141 0.16