Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MJG3

Protein Details
Accession A0A4S8MJG3    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-122QNEGHGQRKDEHRDKRQRRABasic
NLS Segment(s)
PositionSequence
50-91PKPKYGILKSKPTARKRNISRDIRRWEGQKRRAADDKEIAER
110-122RKDEHRDKRQRRA
Subcellular Location(s) nucl 19, cyto_nucl 13, cyto 5
Family & Domain DBs
Amino Acid Sequences PARGRSRTRANLADPGNSLGEDDKLPGAKATGDDSDLPGTQSRAPTPPVPKPKYGILKSKPTARKRNISRDIRRWEGQKRRAADDKEIAERERERSHNNSAGQNEGHGQRKDEHRDKRQRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.41
3 0.34
4 0.28
5 0.24
6 0.16
7 0.15
8 0.12
9 0.12
10 0.11
11 0.11
12 0.11
13 0.11
14 0.11
15 0.1
16 0.11
17 0.12
18 0.11
19 0.12
20 0.12
21 0.14
22 0.15
23 0.14
24 0.14
25 0.12
26 0.13
27 0.13
28 0.14
29 0.14
30 0.14
31 0.17
32 0.21
33 0.26
34 0.33
35 0.41
36 0.43
37 0.43
38 0.44
39 0.48
40 0.52
41 0.51
42 0.52
43 0.47
44 0.52
45 0.53
46 0.59
47 0.61
48 0.6
49 0.65
50 0.61
51 0.66
52 0.65
53 0.73
54 0.74
55 0.76
56 0.76
57 0.76
58 0.77
59 0.73
60 0.69
61 0.63
62 0.63
63 0.63
64 0.63
65 0.6
66 0.57
67 0.57
68 0.61
69 0.59
70 0.55
71 0.52
72 0.47
73 0.47
74 0.45
75 0.4
76 0.37
77 0.36
78 0.34
79 0.34
80 0.34
81 0.33
82 0.36
83 0.43
84 0.45
85 0.47
86 0.48
87 0.44
88 0.44
89 0.39
90 0.35
91 0.32
92 0.3
93 0.34
94 0.3
95 0.31
96 0.33
97 0.42
98 0.51
99 0.57
100 0.62
101 0.65
102 0.75