Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4HAW4

Protein Details
Accession A0A4V4HAW4   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-83LCLARFGRTNRPPRRQQERRRSPSNLRPMPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MLQYDVSSNSTTLHPLLFIVDDYCLVLHLFGDYSKQTSGLEQEQKVSSCCLTRLCLARFGRTNRPPRRQQERRRSPSNLRPMPLHLISLETGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.11
4 0.09
5 0.09
6 0.08
7 0.07
8 0.07
9 0.07
10 0.07
11 0.07
12 0.06
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.07
19 0.06
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.12
26 0.16
27 0.2
28 0.19
29 0.21
30 0.22
31 0.23
32 0.22
33 0.2
34 0.15
35 0.11
36 0.12
37 0.11
38 0.11
39 0.14
40 0.19
41 0.2
42 0.27
43 0.27
44 0.31
45 0.36
46 0.39
47 0.46
48 0.48
49 0.58
50 0.6
51 0.68
52 0.72
53 0.76
54 0.82
55 0.83
56 0.86
57 0.87
58 0.88
59 0.88
60 0.87
61 0.85
62 0.84
63 0.83
64 0.83
65 0.78
66 0.69
67 0.64
68 0.6
69 0.6
70 0.51
71 0.43
72 0.32
73 0.28