Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V4HB05

Protein Details
Accession A0A4V4HB05    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
15-40KPSGHVSSTLKKKKRTRSQTEVNSIDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.333, mito_nucl 11.666, cyto 4
Family & Domain DBs
Amino Acid Sequences MPFKATEKDEDTSFKPSGHVSSTLKKKKRTRSQTEVNSIDAETPLPRRRTRQSISAPDKVVVYENCDKTGLPIQLAVHWDLQEMHKYIFGHGFRWSKFLKTSEIALKHS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.24
4 0.24
5 0.23
6 0.26
7 0.24
8 0.32
9 0.43
10 0.51
11 0.56
12 0.63
13 0.68
14 0.74
15 0.81
16 0.83
17 0.82
18 0.82
19 0.86
20 0.86
21 0.86
22 0.77
23 0.67
24 0.57
25 0.47
26 0.38
27 0.28
28 0.19
29 0.11
30 0.14
31 0.18
32 0.21
33 0.23
34 0.28
35 0.33
36 0.41
37 0.43
38 0.47
39 0.5
40 0.56
41 0.61
42 0.61
43 0.56
44 0.48
45 0.45
46 0.36
47 0.3
48 0.2
49 0.19
50 0.21
51 0.21
52 0.21
53 0.21
54 0.21
55 0.21
56 0.27
57 0.21
58 0.15
59 0.16
60 0.16
61 0.18
62 0.2
63 0.19
64 0.14
65 0.13
66 0.13
67 0.13
68 0.14
69 0.16
70 0.16
71 0.15
72 0.17
73 0.18
74 0.19
75 0.25
76 0.24
77 0.21
78 0.27
79 0.32
80 0.29
81 0.34
82 0.34
83 0.3
84 0.35
85 0.36
86 0.35
87 0.31
88 0.37
89 0.41