Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G9N120

Protein Details
Accession G9N120    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
129-156APESKKAPPPVNRAKKPPPPPIPRKMSTHydrophilic
NLS Segment(s)
PositionSequence
133-153KKAPPPVNRAKKPPPPPIPRK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, mito 6, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MYSNMPVRSQSVRHSVINEAYEGAPPQPVARLTRTMTTREPPPPPPPPASSRPPMLRSATFDSRHPPVIRARAASTSFSRMQTTSVPESRGEDIFDDNSVYSGDNTPSWGDGSVSPATSYGSFHVNQVAPESKKAPPPVNRAKKPPPPPIPRKMSTPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.39
4 0.37
5 0.32
6 0.25
7 0.22
8 0.21
9 0.19
10 0.16
11 0.12
12 0.11
13 0.11
14 0.12
15 0.14
16 0.16
17 0.18
18 0.23
19 0.24
20 0.3
21 0.32
22 0.33
23 0.34
24 0.35
25 0.38
26 0.4
27 0.42
28 0.41
29 0.46
30 0.49
31 0.49
32 0.5
33 0.48
34 0.47
35 0.49
36 0.5
37 0.46
38 0.46
39 0.46
40 0.44
41 0.44
42 0.41
43 0.37
44 0.36
45 0.39
46 0.4
47 0.36
48 0.34
49 0.34
50 0.33
51 0.36
52 0.32
53 0.27
54 0.26
55 0.3
56 0.31
57 0.29
58 0.28
59 0.27
60 0.27
61 0.27
62 0.24
63 0.22
64 0.22
65 0.21
66 0.21
67 0.17
68 0.17
69 0.17
70 0.19
71 0.19
72 0.19
73 0.19
74 0.19
75 0.21
76 0.21
77 0.2
78 0.17
79 0.13
80 0.12
81 0.12
82 0.12
83 0.1
84 0.08
85 0.08
86 0.07
87 0.07
88 0.07
89 0.07
90 0.08
91 0.08
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.09
98 0.08
99 0.12
100 0.12
101 0.12
102 0.11
103 0.11
104 0.12
105 0.11
106 0.12
107 0.09
108 0.11
109 0.12
110 0.12
111 0.17
112 0.16
113 0.16
114 0.2
115 0.25
116 0.24
117 0.26
118 0.29
119 0.27
120 0.33
121 0.38
122 0.42
123 0.44
124 0.52
125 0.61
126 0.69
127 0.73
128 0.76
129 0.8
130 0.82
131 0.83
132 0.84
133 0.84
134 0.83
135 0.86
136 0.87
137 0.86
138 0.79
139 0.77