Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KJD0

Protein Details
Accession A0A4S8KJD0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-127ELKVDQKITFWRRNRERKRNGRSKLGHydrophilic
NLS Segment(s)
PositionSequence
113-127RRNRERKRNGRSKLG
Subcellular Location(s) mito 14, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MATSYKIGAINSVDRTQPSVRNHLRSDLEELVYSGIAVQEFVKNIWSIPEEECERVLSLEWKIQSTLLFDYTQLITKKSPEASYYPVFRAIVHDLLKRYLQELKVDQKITFWRRNRERKRNGRSKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.29
4 0.33
5 0.33
6 0.39
7 0.44
8 0.49
9 0.5
10 0.52
11 0.52
12 0.47
13 0.49
14 0.41
15 0.36
16 0.29
17 0.27
18 0.21
19 0.18
20 0.15
21 0.09
22 0.06
23 0.05
24 0.05
25 0.06
26 0.06
27 0.07
28 0.07
29 0.08
30 0.08
31 0.08
32 0.09
33 0.1
34 0.1
35 0.11
36 0.15
37 0.15
38 0.16
39 0.16
40 0.15
41 0.14
42 0.13
43 0.12
44 0.1
45 0.09
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.11
52 0.1
53 0.1
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.15
60 0.14
61 0.14
62 0.13
63 0.14
64 0.17
65 0.18
66 0.18
67 0.16
68 0.18
69 0.22
70 0.26
71 0.27
72 0.25
73 0.26
74 0.25
75 0.23
76 0.24
77 0.22
78 0.22
79 0.22
80 0.24
81 0.23
82 0.25
83 0.27
84 0.23
85 0.22
86 0.23
87 0.22
88 0.24
89 0.29
90 0.34
91 0.39
92 0.41
93 0.39
94 0.37
95 0.45
96 0.48
97 0.51
98 0.51
99 0.56
100 0.65
101 0.76
102 0.83
103 0.85
104 0.88
105 0.9
106 0.94
107 0.94