Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LVP6

Protein Details
Accession A0A4S8LVP6   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
163-186AFKFPMIFRCYRRRRIHRHSPFQGHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.166, nucl 12, cyto 12, cyto_mito 7.499, cyto_pero 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR011706  Cu-oxidase_C  
IPR008972  Cupredoxin  
Gene Ontology GO:0005507  F:copper ion binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF07731  Cu-oxidase_2  
Amino Acid Sequences MTMQPSSDNKNLDTDNVLAVFHYVGAPDADPTGKPNSFVSLLDQRSELIPLVNPEAPGGSGPADTVINLNLHYDTDTGELEWTINDIKYESPDLPTLLNIMVNIFTNEDQLMTSEHTFVLKRDNIVELQVHGSADGHKHPFHLHGPVFSVVQGMTGAPNFVVAFKFPMIFRCYRRRRIHRHSPFQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.19
5 0.13
6 0.13
7 0.11
8 0.09
9 0.08
10 0.06
11 0.06
12 0.07
13 0.07
14 0.07
15 0.08
16 0.08
17 0.09
18 0.11
19 0.17
20 0.16
21 0.18
22 0.18
23 0.2
24 0.21
25 0.21
26 0.24
27 0.26
28 0.27
29 0.27
30 0.26
31 0.23
32 0.22
33 0.23
34 0.17
35 0.1
36 0.1
37 0.1
38 0.13
39 0.14
40 0.13
41 0.12
42 0.12
43 0.12
44 0.1
45 0.1
46 0.07
47 0.06
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.07
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.07
76 0.09
77 0.08
78 0.09
79 0.1
80 0.1
81 0.1
82 0.1
83 0.09
84 0.07
85 0.07
86 0.06
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.05
97 0.06
98 0.07
99 0.08
100 0.08
101 0.08
102 0.08
103 0.09
104 0.1
105 0.09
106 0.15
107 0.14
108 0.15
109 0.15
110 0.17
111 0.16
112 0.18
113 0.18
114 0.13
115 0.13
116 0.13
117 0.11
118 0.1
119 0.1
120 0.09
121 0.1
122 0.13
123 0.14
124 0.14
125 0.15
126 0.16
127 0.2
128 0.21
129 0.27
130 0.24
131 0.23
132 0.26
133 0.26
134 0.25
135 0.21
136 0.19
137 0.12
138 0.11
139 0.1
140 0.07
141 0.07
142 0.06
143 0.07
144 0.06
145 0.07
146 0.07
147 0.07
148 0.08
149 0.08
150 0.1
151 0.11
152 0.13
153 0.12
154 0.17
155 0.22
156 0.27
157 0.33
158 0.42
159 0.5
160 0.59
161 0.7
162 0.76
163 0.81
164 0.86
165 0.9
166 0.91