Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LRU8

Protein Details
Accession A0A4S8LRU8   
Localization Confidence High
Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-34HYFMSSRSDYRRRDRSRDRDERDRDRDRYBasic
39-71RSYRDEGRRRSSRSRSPRRDRDRRDRRDYDHDHBasic
87-107RGETRRDRDRRDSRRKDDDRDBasic
188-209GDVNIKKMRTWRQYMNRRGGFNHydrophilic
NLS Segment(s)
PositionSequence
17-106RRDRSRDRDERDRDRDRYSRGGRSYRDEGRRRSSRSRSPRRDRDRRDRRDYDHDHDRDRERDRERDRDRDRGETRRDRDRRDSRRKDDDR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSRQSHYFMSSRSDYRRRDRSRDRDERDRDRDRYSRGGRSYRDEGRRRSSRSRSPRRDRDRRDRRDYDHDHDRDRERDRERDRDRDRGETRRDRDRRDSRRKDDDRDRDDRNRKEDTSRRAETSKNSDSKDHLAKPRVNLEPDTNGPQDNDDPMGEIPEDDDAAMMAMMGMSGFGTTKGKHVSGNQEGDVNIKKMRTWRQYMNRRGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.69
4 0.71
5 0.76
6 0.81
7 0.83
8 0.86
9 0.89
10 0.88
11 0.87
12 0.89
13 0.89
14 0.87
15 0.85
16 0.78
17 0.75
18 0.73
19 0.68
20 0.69
21 0.65
22 0.64
23 0.62
24 0.65
25 0.61
26 0.62
27 0.64
28 0.62
29 0.66
30 0.65
31 0.64
32 0.66
33 0.71
34 0.71
35 0.73
36 0.73
37 0.74
38 0.78
39 0.82
40 0.83
41 0.86
42 0.9
43 0.91
44 0.93
45 0.93
46 0.93
47 0.93
48 0.92
49 0.91
50 0.87
51 0.83
52 0.83
53 0.8
54 0.76
55 0.75
56 0.68
57 0.62
58 0.6
59 0.57
60 0.53
61 0.51
62 0.51
63 0.45
64 0.51
65 0.53
66 0.58
67 0.59
68 0.64
69 0.64
70 0.65
71 0.64
72 0.64
73 0.63
74 0.61
75 0.64
76 0.63
77 0.62
78 0.64
79 0.66
80 0.62
81 0.68
82 0.7
83 0.72
84 0.74
85 0.8
86 0.76
87 0.83
88 0.81
89 0.79
90 0.79
91 0.78
92 0.73
93 0.69
94 0.67
95 0.65
96 0.7
97 0.66
98 0.61
99 0.55
100 0.5
101 0.53
102 0.53
103 0.51
104 0.51
105 0.49
106 0.47
107 0.44
108 0.45
109 0.41
110 0.43
111 0.43
112 0.39
113 0.38
114 0.37
115 0.38
116 0.41
117 0.43
118 0.4
119 0.39
120 0.41
121 0.42
122 0.43
123 0.48
124 0.46
125 0.42
126 0.38
127 0.34
128 0.32
129 0.32
130 0.34
131 0.27
132 0.24
133 0.22
134 0.22
135 0.2
136 0.17
137 0.16
138 0.11
139 0.11
140 0.11
141 0.12
142 0.1
143 0.09
144 0.08
145 0.07
146 0.07
147 0.05
148 0.05
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.04
162 0.06
163 0.07
164 0.11
165 0.14
166 0.15
167 0.18
168 0.23
169 0.31
170 0.36
171 0.4
172 0.37
173 0.36
174 0.35
175 0.37
176 0.35
177 0.29
178 0.23
179 0.2
180 0.21
181 0.27
182 0.37
183 0.42
184 0.46
185 0.54
186 0.63
187 0.73
188 0.81
189 0.84
190 0.8
191 0.77
192 0.74
193 0.72
194 0.69
195 0.68
196 0.66