Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8MU93

Protein Details
Accession A0A4S8MU93    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-110YGSEYQPSQRKRKRRHGFLARKRSKSGRKILARRLAKGBasic
NLS Segment(s)
PositionSequence
82-112RKRKRRHGFLARKRSKSGRKILARRLAKGRK
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPPSLAQLLLRPPRLPTASSSFSMALRPAQRLSDFTHQVARPNVSSLVPKTTFMSSILQSLQPQVRFTTYGSEYQPSQRKRKRRHGFLARKRSKSGRKILARRLAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.31
3 0.36
4 0.37
5 0.35
6 0.31
7 0.32
8 0.33
9 0.33
10 0.34
11 0.29
12 0.27
13 0.27
14 0.23
15 0.21
16 0.19
17 0.2
18 0.19
19 0.2
20 0.2
21 0.21
22 0.26
23 0.29
24 0.29
25 0.28
26 0.33
27 0.31
28 0.35
29 0.35
30 0.32
31 0.24
32 0.23
33 0.23
34 0.17
35 0.19
36 0.16
37 0.19
38 0.18
39 0.18
40 0.18
41 0.17
42 0.17
43 0.16
44 0.17
45 0.12
46 0.13
47 0.13
48 0.12
49 0.11
50 0.14
51 0.15
52 0.14
53 0.14
54 0.14
55 0.14
56 0.14
57 0.15
58 0.17
59 0.16
60 0.19
61 0.19
62 0.2
63 0.2
64 0.27
65 0.34
66 0.35
67 0.44
68 0.49
69 0.57
70 0.66
71 0.76
72 0.8
73 0.82
74 0.87
75 0.88
76 0.92
77 0.92
78 0.94
79 0.92
80 0.86
81 0.82
82 0.8
83 0.79
84 0.77
85 0.76
86 0.75
87 0.76
88 0.8
89 0.84
90 0.85
91 0.81
92 0.78
93 0.79
94 0.78
95 0.73
96 0.73