Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4S8KU52

Protein Details
Accession A0A4S8KU52    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
47-66TSPRGKQTKILNRKSEKEDFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 17.5, nucl 14, cyto 13
Family & Domain DBs
Amino Acid Sequences INEPAYEVLLGRPFDCLTESTVQNDREGGQRIMIKDPNTGRRAVIPTSPRGKQTKILNRKSEKEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.14
4 0.13
5 0.17
6 0.17
7 0.19
8 0.25
9 0.25
10 0.24
11 0.23
12 0.2
13 0.2
14 0.23
15 0.2
16 0.17
17 0.19
18 0.19
19 0.22
20 0.24
21 0.21
22 0.21
23 0.25
24 0.3
25 0.29
26 0.29
27 0.26
28 0.27
29 0.3
30 0.27
31 0.29
32 0.25
33 0.31
34 0.36
35 0.38
36 0.4
37 0.41
38 0.42
39 0.43
40 0.5
41 0.54
42 0.59
43 0.67
44 0.71
45 0.75
46 0.79