Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L9M5

Protein Details
Accession E2L9M5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
69-90RGEIRWKRRRIIKEQRVKPICPBasic
NLS Segment(s)
PositionSequence
75-78KRRR
Subcellular Location(s) mito 11, cyto_nucl 8.5, cyto 8, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR037239  OSBP_sf  
KEGG mpr:MPER_02713  -  
Amino Acid Sequences MIITCTGSRGKHFRTVLEYKEESWLGKPHFLIEGVVHTVSEGDTQHEEWTKVKHVPPSRVVAVLDGTWRGEIRWKRRRIIKEQRVKPICPRVLQAIGTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.48
4 0.48
5 0.45
6 0.38
7 0.41
8 0.38
9 0.31
10 0.28
11 0.3
12 0.24
13 0.25
14 0.24
15 0.21
16 0.21
17 0.2
18 0.18
19 0.13
20 0.13
21 0.12
22 0.12
23 0.1
24 0.09
25 0.08
26 0.08
27 0.08
28 0.06
29 0.06
30 0.07
31 0.08
32 0.1
33 0.11
34 0.11
35 0.11
36 0.13
37 0.14
38 0.16
39 0.18
40 0.24
41 0.28
42 0.32
43 0.35
44 0.38
45 0.36
46 0.34
47 0.32
48 0.26
49 0.22
50 0.17
51 0.15
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.14
58 0.21
59 0.31
60 0.4
61 0.45
62 0.53
63 0.62
64 0.7
65 0.73
66 0.78
67 0.78
68 0.79
69 0.82
70 0.86
71 0.83
72 0.78
73 0.76
74 0.75
75 0.71
76 0.63
77 0.58
78 0.54
79 0.53