Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LHH2

Protein Details
Accession A0A4S8LHH2   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-60VKDERNKLRQHQKKKLRNAANYQNNHydrophilic
103-129RANRQLLAKKERERRAQKKAQRLTVQAHydrophilic
NLS Segment(s)
PositionSequence
110-122AKKERERRAQKKA
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTSMRLQPCDQLQLTGAEEDEYLVQAGVAPEDLLFVKDERNKLRQHQKKKLRNAANYQNNRDQRLERARENNMRHRQNFPLLSEAQQNDILEGRQLSHWKYWRANRQLLAKKERERRAQKKAQRLTVQAQKDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.19
4 0.13
5 0.12
6 0.11
7 0.1
8 0.08
9 0.07
10 0.06
11 0.05
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.11
24 0.15
25 0.21
26 0.24
27 0.3
28 0.32
29 0.4
30 0.51
31 0.56
32 0.63
33 0.68
34 0.75
35 0.79
36 0.86
37 0.87
38 0.85
39 0.83
40 0.81
41 0.8
42 0.8
43 0.77
44 0.71
45 0.69
46 0.63
47 0.59
48 0.53
49 0.43
50 0.4
51 0.43
52 0.42
53 0.38
54 0.4
55 0.43
56 0.49
57 0.53
58 0.55
59 0.56
60 0.58
61 0.56
62 0.55
63 0.52
64 0.51
65 0.48
66 0.39
67 0.34
68 0.28
69 0.28
70 0.29
71 0.26
72 0.22
73 0.21
74 0.2
75 0.16
76 0.16
77 0.14
78 0.11
79 0.1
80 0.09
81 0.1
82 0.12
83 0.14
84 0.2
85 0.25
86 0.3
87 0.37
88 0.45
89 0.53
90 0.58
91 0.62
92 0.62
93 0.67
94 0.7
95 0.71
96 0.71
97 0.7
98 0.71
99 0.75
100 0.78
101 0.78
102 0.8
103 0.81
104 0.83
105 0.85
106 0.85
107 0.86
108 0.87
109 0.86
110 0.83
111 0.79
112 0.77
113 0.76