Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8MTV6

Protein Details
Accession A0A4S8MTV6    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-29PPKTSIHTPHTPRRRKVPKSPSKTTQGIHydrophilic
NLS Segment(s)
PositionSequence
13-24PRRRKVPKSPSK
Subcellular Location(s) nucl 20.5, mito_nucl 13.5, mito 5.5
Family & Domain DBs
Amino Acid Sequences MPPKTSIHTPHTPRRRKVPKSPSKTTQGIRTRLPDRLKDAKSIKETLKSELKLSFEPDDWQAHFVHRILQRYDGMCVAATGLGLEALAINEDTEKSSKLWEQLRMTAQIIYLSGDGPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.84
5 0.85
6 0.85
7 0.85
8 0.88
9 0.84
10 0.8
11 0.78
12 0.71
13 0.7
14 0.67
15 0.63
16 0.58
17 0.58
18 0.53
19 0.53
20 0.54
21 0.48
22 0.47
23 0.52
24 0.49
25 0.5
26 0.51
27 0.5
28 0.49
29 0.5
30 0.44
31 0.43
32 0.42
33 0.39
34 0.42
35 0.36
36 0.34
37 0.32
38 0.32
39 0.25
40 0.27
41 0.23
42 0.17
43 0.17
44 0.17
45 0.17
46 0.15
47 0.16
48 0.13
49 0.12
50 0.13
51 0.12
52 0.17
53 0.18
54 0.21
55 0.2
56 0.23
57 0.24
58 0.24
59 0.25
60 0.18
61 0.16
62 0.12
63 0.11
64 0.09
65 0.06
66 0.05
67 0.04
68 0.04
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.06
80 0.08
81 0.09
82 0.09
83 0.12
84 0.15
85 0.21
86 0.26
87 0.32
88 0.35
89 0.4
90 0.43
91 0.43
92 0.42
93 0.37
94 0.32
95 0.25
96 0.22
97 0.17
98 0.14