Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8LA41

Protein Details
Accession A0A4S8LA41   
Localization Confidence Low
Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-22AYRCRICNRCMKKYDHHCPVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_nucl 7, nucl 6, cyto 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS50216  DHHC  
Amino Acid Sequences MTAYRCRICNRCMKKYDHHCPVVRDKPMCWNTQRSGLCHVYPSLNRMCFSLSTVLYVLLGIGNLLTASYYHFRFHMSLSPLISSHSFSPASHVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.76
3 0.81
4 0.79
5 0.78
6 0.72
7 0.71
8 0.74
9 0.72
10 0.68
11 0.59
12 0.51
13 0.53
14 0.53
15 0.51
16 0.45
17 0.43
18 0.39
19 0.46
20 0.47
21 0.38
22 0.41
23 0.39
24 0.35
25 0.3
26 0.29
27 0.23
28 0.22
29 0.23
30 0.21
31 0.2
32 0.2
33 0.19
34 0.19
35 0.15
36 0.16
37 0.16
38 0.12
39 0.11
40 0.11
41 0.11
42 0.1
43 0.09
44 0.08
45 0.04
46 0.04
47 0.03
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.05
55 0.08
56 0.1
57 0.11
58 0.11
59 0.14
60 0.14
61 0.16
62 0.21
63 0.22
64 0.24
65 0.25
66 0.26
67 0.24
68 0.25
69 0.25
70 0.2
71 0.17
72 0.19
73 0.18
74 0.17