Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4S8KN79

Protein Details
Accession A0A4S8KN79   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
189-222TPYQRRWWNKTLDRLRKKCRKLGKKSYRKRFEVEHydrophilic
NLS Segment(s)
PositionSequence
202-218RLRKKCRKLGKKSYRKR
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
IPR005135  Endo/exonuclease/phosphatase  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF14529  Exo_endo_phos_2  
Amino Acid Sequences MKSREAQKIPKCPLHNIWLGDFNQHHQAWDDLINLHLFTARNEKAAEHLLELIAEHNLVMTLEPGVPTLQALTTGNYTRVDNVFCSSGLVDHVVRCEMIPERRQPKTDHMPIVMWVALEAKRIVKEDRLNWRKAEWKELKEELEKELKKLGELKEYETEEEFWNGRQKWQRVIEKIVNNEKLVSRTKMTPYQRRWWNKTLDRLRKKCRKLGKKSYRKRFEVENPIHEVFRIARQKYALEIKKVKAEKWAEWLRQVDEAGLWDIASLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.63
3 0.56
4 0.51
5 0.49
6 0.46
7 0.44
8 0.39
9 0.34
10 0.36
11 0.33
12 0.31
13 0.26
14 0.26
15 0.22
16 0.23
17 0.22
18 0.14
19 0.15
20 0.15
21 0.14
22 0.13
23 0.13
24 0.12
25 0.12
26 0.2
27 0.2
28 0.21
29 0.22
30 0.22
31 0.22
32 0.27
33 0.26
34 0.18
35 0.18
36 0.16
37 0.16
38 0.15
39 0.13
40 0.08
41 0.07
42 0.05
43 0.04
44 0.05
45 0.05
46 0.04
47 0.04
48 0.05
49 0.05
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.05
57 0.06
58 0.07
59 0.08
60 0.1
61 0.11
62 0.13
63 0.14
64 0.14
65 0.15
66 0.16
67 0.16
68 0.14
69 0.15
70 0.14
71 0.13
72 0.13
73 0.11
74 0.1
75 0.09
76 0.1
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.09
84 0.11
85 0.16
86 0.2
87 0.27
88 0.33
89 0.36
90 0.39
91 0.4
92 0.45
93 0.49
94 0.52
95 0.47
96 0.42
97 0.39
98 0.37
99 0.36
100 0.27
101 0.18
102 0.11
103 0.1
104 0.09
105 0.09
106 0.09
107 0.08
108 0.09
109 0.11
110 0.11
111 0.14
112 0.18
113 0.23
114 0.34
115 0.39
116 0.4
117 0.39
118 0.4
119 0.44
120 0.41
121 0.45
122 0.4
123 0.37
124 0.4
125 0.42
126 0.42
127 0.38
128 0.38
129 0.3
130 0.33
131 0.3
132 0.26
133 0.27
134 0.25
135 0.22
136 0.26
137 0.25
138 0.23
139 0.24
140 0.26
141 0.27
142 0.28
143 0.28
144 0.24
145 0.24
146 0.18
147 0.19
148 0.16
149 0.13
150 0.19
151 0.18
152 0.23
153 0.28
154 0.3
155 0.36
156 0.44
157 0.49
158 0.46
159 0.53
160 0.55
161 0.53
162 0.57
163 0.58
164 0.52
165 0.45
166 0.42
167 0.37
168 0.33
169 0.32
170 0.28
171 0.23
172 0.24
173 0.29
174 0.36
175 0.43
176 0.49
177 0.52
178 0.59
179 0.66
180 0.72
181 0.74
182 0.73
183 0.75
184 0.72
185 0.76
186 0.77
187 0.78
188 0.8
189 0.82
190 0.86
191 0.86
192 0.86
193 0.84
194 0.84
195 0.83
196 0.84
197 0.86
198 0.86
199 0.87
200 0.92
201 0.94
202 0.93
203 0.87
204 0.8
205 0.78
206 0.76
207 0.76
208 0.73
209 0.67
210 0.65
211 0.61
212 0.58
213 0.48
214 0.4
215 0.3
216 0.32
217 0.35
218 0.29
219 0.3
220 0.32
221 0.33
222 0.37
223 0.46
224 0.43
225 0.44
226 0.49
227 0.49
228 0.56
229 0.58
230 0.53
231 0.52
232 0.51
233 0.45
234 0.49
235 0.55
236 0.5
237 0.54
238 0.56
239 0.49
240 0.47
241 0.44
242 0.34
243 0.26
244 0.25
245 0.2
246 0.17
247 0.14